Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate GFF2028 Psest_2071 hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__psRCH2:GFF2028 Length = 259 Score = 220 bits (560), Expect = 3e-62 Identities = 119/260 (45%), Positives = 163/260 (62%), Gaps = 11/260 (4%) Query: 1 MNLNSIPAFDDNYIWVLNDEAG-RCLIVDPGDAEPVLNAIAAN-NWQPEAIFLTHHHHDH 58 + + ++PAF DNYIW+L D+A RC VDPGDA PVL+ + + +W+ I +THHHHDH Sbjct: 2 LKIEALPAFTDNYIWLLQDDATQRCAAVDPGDAAPVLSWLQDHLDWRLSDILITHHHHDH 61 Query: 59 VGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHICYF 118 VGGV+ L + VYGP + + DG+ VL + VIA PGHTLGHI Y Sbjct: 62 VGGVERLKTQ-TGARVYGPAAENIPARDEALSDGQRIRVLDKDLEVIAVPGHTLGHIAYV 120 Query: 119 ----SKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKF 174 +P+L GDTLF+ GCGRLFEGT QM+ SL++L++LPDDTLV C HEYTLSN++F Sbjct: 121 HSDAEQPWLLSGDTLFAAGCGRLFEGTPEQMFASLQRLASLPDDTLVYCTHEYTLSNLRF 180 Query: 175 ALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLL 234 A ++ P++ I R+V LR +N +LP + ER N FLR+ ++ + E Sbjct: 181 AQAVEPYNQEIQQRVREVTALREENHFSLPTRMNIERATNPFLRS-SVEAVQQAASEHCG 239 Query: 235 QQPEER---FAWLRSKKDRF 251 ++ E+ FA LR+ KDRF Sbjct: 240 RRLEDEVAVFAALRAWKDRF 259 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 259 Length adjustment: 24 Effective length of query: 227 Effective length of database: 235 Effective search space: 53345 Effective search space used: 53345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF2028 Psest_2071 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.15438.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-107 343.9 0.0 2.7e-107 343.7 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF2028 Psest_2071 hydroxyacylglutathion Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF2028 Psest_2071 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 343.7 0.0 2.7e-107 2.7e-107 1 248 [] 4 259 .] 4 259 .] 0.98 Alignments for each domain: == domain 1 score: 343.7 bits; conditional E-value: 2.7e-107 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeek.glkleaillTHhHaDHvggvaellekfpvkvvg 73 i+a+pa++dNyiwll+d+++ ++++vDpg+a+pvl++l+++ +++l++il+THhH+DHvggv++l+++++++v+g lcl|FitnessBrowser__psRCH2:GFF2028 4 IEALPAFTDNYIWLLQDDATqRCAAVDPGDAAPVLSWLQDHlDWRLSDILITHHHHDHVGGVERLKTQTGARVYG 78 6789**************999*****************98879******************************** PP TIGR03413 74 paeeripgltkevkegdevellelevevlevpGHtlgHiayyleee..kvlFcgDtLfsaGCGrlfegtaeqmle 146 pa+e+ip+ ++++++g+++++l++++ev++vpGHtlgHiay+ +++ ++l +gDtLf+aGCGrlfegt+eqm++ lcl|FitnessBrowser__psRCH2:GFF2028 79 PAAENIPARDEALSDGQRIRVLDKDLEVIAVPGHTLGHIAYVHSDAeqPWLLSGDTLFAAGCGRLFEGTPEQMFA 153 ******************************************9876669************************** PP TIGR03413 147 slqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeea 221 slq+la+Lp++t+vyc+HEYtlsNlrFa+avep n+++++r++ev+alr++++ +lP++++ e+atNpFLr + + lcl|FitnessBrowser__psRCH2:GFF2028 154 SLQRLASLPDDTLVYCTHEYTLSNLRFAQAVEPYNQEIQQRVREVTALREENHFSLPTRMNIERATNPFLRSSVE 228 *************************************************************************** PP TIGR03413 222 evkaalee....ekaeevevfaelRekkdkf 248 +v++a++e + ++ev+vfa+lR++kd+f lcl|FitnessBrowser__psRCH2:GFF2028 229 AVQQAASEhcgrRLEDEVAVFAALRAWKDRF 259 ***999998998999**************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory