Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate GFF875 Psest_0895 Threonine dehydrogenase and related Zn-dependent dehydrogenases
Query= curated2:Q65JE7 (346 letters) >FitnessBrowser__psRCH2:GFF875 Length = 379 Score = 120 bits (302), Expect = 4e-32 Identities = 117/390 (30%), Positives = 176/390 (45%), Gaps = 61/390 (15%) Query: 5 MKALIKKPGEPGASFELVPIPKIDKH-EVLIKVKAASICGTDVHIYNWDEWAKSRVKPPY 63 MKA++ G S + VP KI++ + L++V + +ICG+D+H+Y ++ + Sbjct: 1 MKAIVYN-GPRDVSVQNVPDAKIERPTDALVRVTSTNICGSDLHMYE----GRTTFETGR 55 Query: 64 VFGHEFSGEVVQVGENVTTVKEGEYVSAETHIVCGKCLPCLTGKEHVCKKTLILGVDT-- 121 VFGHE GEVV+VG V VK G+ V +I CG C C G C Sbjct: 56 VFGHENLGEVVEVGAGVERVKVGDMVCLPFNIGCGFCENCEKGLTGYCLTANPGSAGAAY 115 Query: 122 --------DGCFAEYVKMPAANIWKNPAGMPEDLASIQE---------PLGNAVHTVLTG 164 DG AE +++P A+ N +PED ++ P G T L G Sbjct: 116 GFAEMGTYDGGQAELLRVPFADF--NCLVLPEDAKEREDDYVMLSDIFPTGWHA-TRLAG 172 Query: 165 MTAGVKVAVVGCGPIGLMAVAVAKASGAAQVIAIDKNEYRLDLALQMGATDIISVEKEDP 224 + G +A+ G GP+GLMA A GA+QV ID RL LA QMGAT I SVE++ Sbjct: 173 LQPGESIAIYGAGPVGLMAAHSALIQGASQVFVIDDQPDRLKLAAQMGATPINSVEQK-A 231 Query: 225 LKNVSALTNGEGADLVCEMSGHPTAIRQSLKM-------------AANGGRVHVLSLPEH 271 + + T+G+G D CE G+ + ++ A G V L +P+ Sbjct: 232 VDEILNYTDGKGTDRGCECVGYQCCDKHGHEVNHLTMNNLVASTKATGGIGVVGLFVPQD 291 Query: 272 P-----------VCIDMTNDIVFKGLTVQGITGRKMFETW-RQVSGLLQSGTIQIKPVIT 319 P + D FKG + TG+ + + RQ++ L+ G +++ Sbjct: 292 PGAKNELAKEGKMAFDF-GSFWFKGQKIG--TGQANVKAYNRQLAELIHHGRAAPSQIVS 348 Query: 320 HRFPMEE---FEKGFELMRKGQCGKVVLIP 346 HR +++ K F+ KG KVV+ P Sbjct: 349 HRLKLDDGPSAYKHFDARDKGWT-KVVMKP 377 Lambda K H 0.318 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 379 Length adjustment: 29 Effective length of query: 317 Effective length of database: 350 Effective search space: 110950 Effective search space used: 110950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory