Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate GFF3154 Psest_3213 acetate kinase
Query= BRENDA::E3W769 (401 letters) >FitnessBrowser__psRCH2:GFF3154 Length = 395 Score = 384 bits (987), Expect = e-111 Identities = 204/401 (50%), Positives = 269/401 (67%), Gaps = 7/401 (1%) Query: 1 MSDKLVLVLNCGSSSLKFAIIDAQSGDDKISGLAECFGLEDSRIKWKFNGGKNEAKLGAF 60 MS + +LV+NCGSSS+KFA+++ + GLAEC G ++ I ++ GK K+ Sbjct: 1 MSARNILVINCGSSSIKFALVNEAQATFPLQGLAECIGSPEAVIHFESAAGKESVKVPN- 59 Query: 61 TAHREAVEFFIVNNILAEHPELAA-QIKAIGHRIVHGGEKFTRSVIITPEVIQGIEDCAS 119 H+ A+ IL E A + IGHR+VHGGEKF S ++ E + GIE Sbjct: 60 ADHQAALA-----QILPRVEEAAGGHLDGIGHRVVHGGEKFFASSLLNDETLAGIEANIQ 114 Query: 120 LAPLHNPAHLIGIRAAIASFPQLPQVTVFDTAFHQTMPEKAYIYALPYKLYREHSIRRYG 179 LAPLHNPA+L GI AAI FP+LPQV VFDTAFHQTMPE AY YA+P LY+EH +RRYG Sbjct: 115 LAPLHNPANLSGIHAAINLFPELPQVGVFDTAFHQTMPEHAYRYAVPDVLYKEHGVRRYG 174 Query: 180 MHGTSHFYVCREAAKVLGKDVKDINVICAHLGNGASVAAIKGGKSVDTSMGLTPLEGLVM 239 HGTSH +V + AA++ G V++ + + AHLGNG S A+ G+S DTSMGLTPLEGLVM Sbjct: 175 FHGTSHRFVSKRAAEMAGVPVENSSWLVAHLGNGCSTCAVVNGESRDTSMGLTPLEGLVM 234 Query: 240 GTRCGDLDPSIIFHLVKQLGYTLDEVNNLLNKQSGLLGISELTNDCRGIEEGYHDGHKGA 299 GTR GD+DPS+ L K LG+ L +++N+LNK+SGL G+S L+ND R + + + GH GA Sbjct: 235 GTRSGDVDPSLHNFLNKTLGWDLAKIDNMLNKESGLKGLSGLSNDMRTLADARNAGHPGA 294 Query: 300 TLALDIFCYRLAKYIASYTVPLGRLDAIIFTGGIGENSNLIREKVLNLLEIFNFKVDDIL 359 LA D+FCYRLAK +A+ + L +LD ++FTGGIGENS+ +RE+ L L++F FK+D Sbjct: 295 VLAFDVFCYRLAKSLAAMSCALPQLDGLVFTGGIGENSSAVRERTLEHLKLFGFKLDAEA 354 Query: 360 NKAARFGQQGVITQAGTPIAMVIPTNEEWVIAEDAIKLITA 400 N G G I AG+P MV+PTNEE IA D + L+ A Sbjct: 355 NARCTRGVAGEIQAAGSPRIMVVPTNEERQIALDTLALLDA 395 Lambda K H 0.321 0.139 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 395 Length adjustment: 31 Effective length of query: 370 Effective length of database: 364 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF3154 Psest_3213 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.22042.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-143 464.9 0.0 1.1e-143 464.7 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF3154 Psest_3213 acetate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF3154 Psest_3213 acetate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.7 0.0 1.1e-143 1.1e-143 2 403 .. 2 392 .. 1 394 [. 0.95 Alignments for each domain: == domain 1 score: 464.7 bits; conditional E-value: 1.1e-143 TIGR00016 2 kskkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkllntlk 76 + + ilv+n+Gsss+kfal++ ++ + l+gl+e+i ++ea+i e++ ke+ k+ +dh++a++++l +++ lcl|FitnessBrowser__psRCH2:GFF3154 2 SARNILVINCGSSSIKFALVNEAQ-ATFPLQGLAECIGSPEAVIH-FESAAGKESVKVPNADHQAALAQILPRVE 74 5678******************96.55669************666.6777788999999**************** PP TIGR00016 77 kdkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvav 151 + +++ iGHRvvhGgekf s +++de+l++i+ ++lAPlHnpa+l+gi+a+ + ++ ++v v lcl|FitnessBrowser__psRCH2:GFF3154 75 E-----AAGGHLDGIGHRVVHGGEKFFASSLLNDETLAGIEANIQLAPLHNPANLSGIHAAI--NLFPELPQVGV 142 5.....67899***************************************************..6667788**** PP TIGR00016 152 FDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknG 226 FDtafHqt+pe+ay Ya+P lyke+gvRrYGfHGtsh++v++raa++ + p++++ +v+HlGnG s +av nG lcl|FitnessBrowser__psRCH2:GFF3154 143 FDTAFHQTMPEHAYRYAVPDVLYKEHGVRRYGFHGTSHRFVSKRAAEMAGVPVENSSWLVAHLGNGCSTCAVVNG 217 *************************************************************************** PP TIGR00016 227 ksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegne 301 +s dtsmGltPLeGlvmGtRsGd+Dp++ ++l++tlg l++i ++lnk+sGl g+sgls+D+R++ d+ ++g+ lcl|FitnessBrowser__psRCH2:GFF3154 218 ESRDTSMGLTPLEGLVMGTRSGDVDPSLHNFLNKTLGWDLAKIDNMLNKESGLKGLSGLSNDMRTLADARNAGHP 292 *************************************************************************** PP TIGR00016 302 eaklAlkvyvhRiakyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvi 376 a lA++v+++R+ak ++++ +l + lD++vFtgGiGen++ vre++le+l+++G+kld e n ++++g + i lcl|FitnessBrowser__psRCH2:GFF3154 293 GAVLAFDVFCYRLAKSLAAMSCALPQ-LDGLVFTGGIGENSSAVRERTLEHLKLFGFKLDAEANARCTRGVAGEI 366 ************************66.************************************************ PP TIGR00016 377 steeskvkvlviptneelviaeDalrl 403 s +++v+ptnee ia D+l l lcl|FitnessBrowser__psRCH2:GFF3154 367 QAAGS-PRIMVVPTNEERQIALDTLAL 392 96655.689**************9877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (395 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.88 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory