Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate GFF851 Psest_0865 ABC-type maltose transport systems, permease component
Query= uniprot:A8LLL4 (385 letters) >FitnessBrowser__psRCH2:GFF851 Length = 296 Score = 87.8 bits (216), Expect = 4e-22 Identities = 65/213 (30%), Positives = 109/213 (51%), Gaps = 9/213 (4%) Query: 179 FNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPLLTLHN 238 +N++ + ++I+ +L++ +AYA A M F G+A ++ ++ + P L+L+ + L + Sbjct: 86 WNSVKIAFVSSILILLLSTTSAYAFARMRFGGKAPILKSMLIFQMFPPVLSLVAIYALFD 145 Query: 239 AIGIGKGYLGT------WLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIFT 292 +G +LG +A G GM L I+ ++ Y + + E A VDGAT +Q F Sbjct: 146 QLGQHVSWLGVNSHGAVIVASLG-GMALHIWTIKGYFESIDASLEEAAIVDGATTWQAFF 204 Query: 293 KIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIVELLGTRGGNWEI 352 I+LP+S P LA I F+ + + +A V L+D T + Q + L + W Sbjct: 205 HILLPMSVPILAVVFILAFITSVTEYPIASVLLMDVDKLTLSVGAQ--QYLYPQNYLWGD 262 Query: 353 LATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 A AA +S VF Q+++V GL AG VK Sbjct: 263 FAAAAVLSGLPITAVFLYCQKWIVGGLTAGGVK 295 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 296 Length adjustment: 28 Effective length of query: 357 Effective length of database: 268 Effective search space: 95676 Effective search space used: 95676 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory