GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pgmA in Pseudomonas stutzeri RCH2

Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate GFF945 Psest_0974 phosphoglucosamine mutase

Query= metacyc::MONOMER-13382
         (455 letters)



>lcl|FitnessBrowser__psRCH2:GFF945 Psest_0974 phosphoglucosamine
           mutase
          Length = 445

 Score =  210 bits (535), Expect = 7e-59
 Identities = 142/449 (31%), Positives = 226/449 (50%), Gaps = 33/449 (7%)

Query: 3   KLFGTFGVRG-IANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEAL 61
           K FGT G+RG +    ITP+F +K+G A G   +++G+ +  +++G+DTR+SG M + AL
Sbjct: 4   KYFGTDGIRGHVGQAPITPDFMLKLGWAAGMAFRKQGKCR--ILIGKDTRISGYMFESAL 61

Query: 62  ISGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLK 121
            +GL + G DV+ +G  PTPAV + T+ F+A+ G VI+ASHNP   NGIK     G  L 
Sbjct: 62  QAGLSAAGADVLLLGPMPTPAVAYLTRTFHAEAGIVISASHNPHHDNGIKFFSGRGTKLP 121

Query: 122 KEREAIVEELFFKEDFDRAKWYEIGEVRR-EDIIKPYIEAIKSKV----DVEAIKKRKPF 176
            E E ++EEL         +  ++G+  R  D    YIE  KS V    D   +K     
Sbjct: 122 DEVELMIEEL-IDAPMTVVESAQLGKASRINDAAGRYIEFCKSSVPTSTDFSGLK----- 175

Query: 177 VVVDTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGA 236
           +V+D ++GA     P + RELG +V+ + AQPDG     N +    ++ +  + V   GA
Sbjct: 176 LVIDCAHGATYKVAPSVFRELGAEVVVIGAQPDGL--NINADVGSTHVGQLQKAVVDHGA 233

Query: 237 DFGVAQDGDADRAVFIDENGRFIQGDKTFALVA-DAVLKEKGGGLLVTTVATSNLLDDIA 295
           D G+A DGD DR + +D  G  + GD+   ++A D   +++  G +V T+ ++  L+   
Sbjct: 234 DLGIAFDGDGDRVMMVDHTGAVVDGDELLYIIATDLQERDRLSGGVVGTLMSNLGLELAL 293

Query: 296 KKHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAK 355
           K       R KVGD  V   + + +  +GGE +G ++  +H    D  +   +VV    +
Sbjct: 294 KARDIPFTRAKVGDRYVIAEMLDRSWVLGGENSGHIVCAQHTTTGDAIIAALQVVLALRR 353

Query: 356 SGKKFSELIDELPKYYQIKTKRHVEGDR----HAIVNKVAEMARERGYTVDTTDGAKIIF 411
            G+  ++      K  Q+       GDR    H  V    +   ER            + 
Sbjct: 354 RGQTLAQERLAWHKCPQVLINVRFSGDRDPISHPSVQAACDSVTER------------MA 401

Query: 412 EDGWVLVRASGTEPIIRIFSEAKSKEKAQ 440
             G VL+R SGTEP++R+  E   + + +
Sbjct: 402 GRGRVLLRKSGTEPLVRVMVEGDDETQVR 430


Lambda     K      H
   0.317    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 481
Number of extensions: 38
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 455
Length of database: 445
Length adjustment: 33
Effective length of query: 422
Effective length of database: 412
Effective search space:   173864
Effective search space used:   173864
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory