Align Trehalose/maltose transport system permease protein MalG (characterized)
to candidate GFF851 Psest_0865 ABC-type maltose transport systems, permease component
Query= SwissProt::Q7LYX6 (278 letters) >FitnessBrowser__psRCH2:GFF851 Length = 296 Score = 120 bits (301), Expect = 3e-32 Identities = 89/282 (31%), Positives = 144/282 (51%), Gaps = 22/282 (7%) Query: 15 AILMAIIC--LFPFIWMIVVSFAEDPTFLGSPLVEYKSTLENYVRVLSDPTLH------- 65 A L+A + LFP + +I +SF E GS E TLE++ L P H Sbjct: 18 AALLAFVAAILFPLLMVISISFREGNFATGSLFPE-NPTLEHWSLALGIPYTHADGSVTQ 76 Query: 66 --FPA--YLKNSIIIASLVTLTTVSISSLAAYAVSRIEFKGRLLIPIFVLGLSMFPQISL 121 FP +L NS+ IA + ++ + +S+ +AYA +R+ F G+ I +L MFP + Sbjct: 77 PPFPVLLWLWNSVKIAFVSSILILLLSTTSAYAFARMRFGGKAPILKSMLIFQMFPPVLS 136 Query: 122 VGYLFKFIEKLG----W--VNTYQALYFPYVAWTLPLSLWILLSYFSQLPKDLDEAAMID 175 + ++ ++LG W VN++ A+ + + L +W + YF + L+EAA++D Sbjct: 137 LVAIYALFDQLGQHVSWLGVNSHGAVIVASLGG-MALHIWTIKGYFESIDASLEEAAIVD 195 Query: 176 GASRIKTLTTIILPLSAPALFSTALLVFIAAFNEFMFALLFTTDHRARTVPVGIALFQGV 235 GA+ + I+LP+S P L +L FI + E+ A + D T+ VG + Sbjct: 196 GATTWQAFFHILLPMSVPILAVVFILAFITSVTEYPIASVLLMDVDKLTLSVGAQQYLYP 255 Query: 236 HGEIPWGSVMAASVISTIPLVIMALLFQKYIVSGLTAGALKG 277 + WG AA+V+S +P+ + L QK+IV GLTAG +KG Sbjct: 256 QNYL-WGDFAAAAVLSGLPITAVFLYCQKWIVGGLTAGGVKG 296 Lambda K H 0.329 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 296 Length adjustment: 26 Effective length of query: 252 Effective length of database: 270 Effective search space: 68040 Effective search space used: 68040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory