GapMind for catabolism of small carbon sources

 

Aligments for a candidate for treC in Pseudomonas stutzeri RCH2

Align trehalose-6-phosphate hydrolase (TreC) (EC 3.2.1.93) (characterized)
to candidate GFF3716 Psest_3785 Glycosidases

Query= CAZy::AAC77196.1
         (551 letters)



>lcl|FitnessBrowser__psRCH2:GFF3716 Psest_3785 Glycosidases
          Length = 511

 Score =  337 bits (863), Expect = 9e-97
 Identities = 203/549 (36%), Positives = 288/549 (52%), Gaps = 62/549 (11%)

Query: 7   WWQNGVIYQIYPKSFQDTTGSGTGDLRGVIQHLDYLHKLGVDAIWLTPFYVSPQVDNGYD 66
           WW+   +YQIYP+SF D+ G G GDL GV++HLD+L +LGVDA+WL+P + SP  D GYD
Sbjct: 9   WWKGATVYQIYPRSFADSNGDGIGDLNGVLRHLDHLQQLGVDALWLSPIFRSPMADAGYD 68

Query: 67  VANYTAIDPTYGTLDDFDELVTQAKSRGIRIILDMVFNHTSTQHAWFREA-LNKESPYRQ 125
           +++Y  IDP +G+L D D L+ +A +R IR++LD V NHTS +H WF E+  ++++P R 
Sbjct: 69  ISDYCDIDPLFGSLADIDRLIAEAHARNIRVLLDFVPNHTSDEHPWFVESRSSRDNPKRD 128

Query: 126 FYIWRDGEPETPPNNWRSKFG-GSAWRWHAESEQYYLHLFAPEQADLNWENPAVRAELKK 184
           +YIWRD      PNNWR+  G GSAW W   ++QYYLHLF  +Q DLNW NP V   +  
Sbjct: 129 WYIWRD-----QPNNWRAALGAGSAWTWDEHTQQYYLHLFLAKQPDLNWRNPEVVEAMHD 183

Query: 185 VCEFWADRGVDGLRLDVVNLISKDPRFPED---LDGDGRRFYTDGPRAHEFLHEMNRDVF 241
           V  FW DRG+DG R+DV++   KD  F +D     G     + D P +HE L  + + V 
Sbjct: 184 VLRFWLDRGIDGFRIDVIHCTGKDLSFADDPRCQAGQPLSDFNDQPYSHEVLRGLRKLVD 243

Query: 242 T-PRGLMTVGEMSSTSLEHCQRYAALTGSELSMTFNFHHLKVDYPGGEKWTLAKPDFVAL 300
           + P   M VGE++  S E   +Y    G EL + FNF+ L   +           D V  
Sbjct: 244 SYPGDRMLVGEVNIRSTERVLQYYG-AGDELHLAFNFNPLDAPW-----------DPVLF 291

Query: 301 KTLFR---HWQQGMHNVAWNALFWCNHDQPRIVSRFGDEGEYRVPAAKMLAMVLHGMQGT 357
           +T  R   HW Q     AW      NHD  R  SR+   G  R  AA+  A++L  ++GT
Sbjct: 292 RTCIREVEHWLQPAG--AWPTWVLSNHDNVRQRSRY--RGSER--AARAAAVLLLTLRGT 345

Query: 358 PYIYQGEEIGMTNPHFTRITDYRDVESLNMFAELRNDGRDADELLAILASKSRDNSRTPM 417
           P+IYQGEE+G+ + H                  +R++ R        +    RD  R P+
Sbjct: 346 PFIYQGEELGLEDAH------------------IRDEAR--------IDPGGRDGCRAPI 379

Query: 418 QWSNGDNAGFTAGEPWIGLGDNYQQINVEAALADDSSVFYTYQKLIALRKQEAILTWGNY 477
            W      G+   EPW+    +  ++  E      +S+F  YQ+L+A RK    L  G++
Sbjct: 380 PWQAEPPHGWQGAEPWLPFPPDAAELAAERQTGAANSIFALYQRLLAARKASPALHHGDF 439

Query: 478 QDLLPNSPVLWCYRREWKGQTLLVIANLSREIQPWQAGQMRGNWQLVMHNYEEASPQPCA 537
           ++L  +  VL  YRR+      LV  N S   QP  A    G+W + + +       P  
Sbjct: 440 EELASHPEVL-AYRRQHGDDCRLVCINFSE--QP-HAHPHAGDWHVEIASDGVGENAPYN 495

Query: 538 MNLRPFEAV 546
             L P +AV
Sbjct: 496 GTLNPGQAV 504


Lambda     K      H
   0.320    0.136    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1067
Number of extensions: 65
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 551
Length of database: 511
Length adjustment: 35
Effective length of query: 516
Effective length of database: 476
Effective search space:   245616
Effective search space used:   245616
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory