Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate GFF3784 Psest_3853 ABC-type branched-chain amino acid transport systems, ATPase component
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__psRCH2:GFF3784 Length = 266 Score = 157 bits (396), Expect = 3e-43 Identities = 94/253 (37%), Positives = 145/253 (57%), Gaps = 12/253 (4%) Query: 8 VVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFE 67 V+L G+ K FGG A+++V + ++ QV+ LIGPNGAGKTT FN++T P AG+ Sbjct: 20 VMLSARGLRKEFGGFVAVNNVDLDVRHAQVHALIGPNGAGKTTVFNLLTKFLQPSAGSIR 79 Query: 68 LAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGL---FGAVFRT 124 L T +VA+ G+ R+FQ +F +T L+NV V ++ GL F R+ Sbjct: 80 LLDHDITRTDPAKVARMGLVRSFQISAVFPHLTVLDNVRVA--LQRPGGLATQFWLPMRS 137 Query: 125 KGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEP 184 + +RA +L++ VG+ A LSYG +R LEIA LA +P+++ LDEP Sbjct: 138 LN------RLNERALQLIESVGLADKRHELAADLSYGRKRVLEIATTLALEPKVLLLDEP 191 Query: 185 AAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 AGM + + E+I + R +L++EH++K+V LC +VTVL G+ + G+ V Sbjct: 192 MAGMGHEDVHVVAEIIREVAT-QRAVLMVEHNLKVVADLCHQVTVLQRGEILTSGDYRTV 250 Query: 245 QKNEKVIEAYLGT 257 ++E+V AY+GT Sbjct: 251 SQDERVRVAYMGT 263 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 266 Length adjustment: 25 Effective length of query: 235 Effective length of database: 241 Effective search space: 56635 Effective search space used: 56635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory