Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate GFF1279 Psest_1312 ABC-type branched-chain amino acid transport systems, periplasmic component
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__psRCH2:GFF1279 Length = 372 Score = 184 bits (467), Expect = 3e-51 Identities = 123/376 (32%), Positives = 195/376 (51%), Gaps = 10/376 (2%) Query: 1 MQLKLKLTVVAAIAAAAGVAS--AQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELN 58 M+ K +L+ + A G AS ++IG PV+G A YG GA MAIE++N Sbjct: 1 MKTKQRLSKIFLAMALTGAASYTLAADTIRIGLAGPVTGPVAQYGDMQFIGAEMAIEQIN 60 Query: 59 AQGVTIGGKKIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYND 118 G + G ++K V DDA DPKQ A A K+ + V VVGHL S +T PAS +Y D Sbjct: 61 KAG-GVNGAQLKG--VRYDDACDPKQAVAVANKIVNDNVKFVVGHLCSSSTQPASDIYED 117 Query: 119 CGIPHVTGAATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYG 178 GI +T A+T+P++T GY+ FR I D+ G + D +K K VA+I D+ YG Sbjct: 118 EGILMITAASTSPDITSRGYELIFRTIGLDSLQGPTAGNFIADHVKPKNVAVIHDKQQYG 177 Query: 179 QGVADVFKKTATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLR 238 +G+A K+T K +KV + DF +++ +K + D ++YGG P+ G +LR Sbjct: 178 EGIATAVKQTLEGKNIKVGLFEGINAGDKDFSSLIAKLKREGVDFVYYGGYHPELGLLLR 237 Query: 239 QMEQLGMGNVKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDA 298 Q ++ G+ NV++ G +G+ SEI+ + AG + G + S + P + A Sbjct: 238 QSKEKGL-NVRFMGPEGVGNSEISAI-AGPASEGMYVTLP--KSFDQDPRNKELVDGFKA 293 Query: 299 KYPNQFQVYSPYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMK 358 K + + Y A +I + +++A S D L ++F T ++F+ G++K Sbjct: 294 KKQDPSGPFVFPAYAAVQVIAEGIEKAGSTDTDKVAEALRSNTFDTPTGMLSFDEKGDLK 353 Query: 359 NPAITLYV-YKDGKKT 373 + +Y ++DG KT Sbjct: 354 DFNFVVYEWHQDGTKT 369 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 372 Length adjustment: 30 Effective length of query: 345 Effective length of database: 342 Effective search space: 117990 Effective search space used: 117990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory