Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate GFF2033 Psest_2076 Enoyl-CoA hydratase/carnithine racemase
Query= reanno::WCS417:GFF2712 (367 letters) >FitnessBrowser__psRCH2:GFF2033 Length = 270 Score = 72.8 bits (177), Expect = 1e-17 Identities = 59/195 (30%), Positives = 94/195 (48%), Gaps = 14/195 (7%) Query: 22 EVRNHIGHLTLNRPAGLNAITLNMVRRLASQLKAWAD-DPQVYAVVLRGAGEKAFCAGGD 80 E+ + I + +NRP +NA+ + W D +V VVL GAGE F +G D Sbjct: 10 ELADKIARVVINRPEKINAMDAAFWSEIIDIFN-WVDATDEVRVVVLSGAGEH-FSSGID 67 Query: 81 IRSLY--------DSFKNGDTLHQDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLV 132 ++ L D +N + L + + + + A+ H RKPV+A + G+ LGG + L+ Sbjct: 68 LQLLASVGSQLGNDVGRNAERLRRKILSLQASFN-AVDHCRKPVIAAIQGYCLGGAIDLI 126 Query: 133 QGADLRVVTERSRLAMPEVAIGYFPDVGGSYFLPRIPGE-LGIYLGVTGVQIRAADALYC 191 D+R T ++ ++ E+ +G DVG LPRI G+ + L TG I +A Sbjct: 127 SACDMRYSTASAKFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRTIDGEEARSI 186 Query: 192 GLAD-WYLESSKLAD 205 GL + Y + L D Sbjct: 187 GLVNRTYADQQALMD 201 Lambda K H 0.322 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 270 Length adjustment: 27 Effective length of query: 340 Effective length of database: 243 Effective search space: 82620 Effective search space used: 82620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory