Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate GFF2175 Psest_2218 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit
Query= metacyc::MONOMER-11684 (327 letters) >FitnessBrowser__psRCH2:GFF2175 Length = 324 Score = 259 bits (662), Expect = 6e-74 Identities = 137/321 (42%), Positives = 209/321 (65%), Gaps = 3/321 (0%) Query: 4 MSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAI 63 +SY +A+ A++E ++RD R F++GEDVGR GG + + GL E+FGE R+ DTPL+E A Sbjct: 5 ISYREALREALREALQRDERAFLMGEDVGRYGGTYAVSKGLLEEFGEARIRDTPLSELAF 64 Query: 64 AGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGV 123 G GIGAA+ GMRPI E+ +F + A++ +I+ AA +R+ S +S P+V+R G G Sbjct: 65 VGAGIGAALGGMRPIVEVMTVNFALLALDPLINTAATLRHMSGGQFSVPLVLRMATGAGR 124 Query: 124 HGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGE 183 A HS S+E FA+ PGLK++ P+T DA+G+L A++D DPVL FEH + Y L + E Sbjct: 125 QLAAQHSHSLEGWFAHVPGLKVLAPATVEDARGMLWPALQDPDPVLIFEHAQLYNL-EDE 183 Query: 184 VPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLD 243 +P + I A V+R G D+++I YG +H ALQAA++L ++GI+A V+DLR + PLD Sbjct: 184 LP-PSMAVDIRSARVRRPGSDLSLIAYGGTLHKALQAADQLAEEGIAAEVIDLRVLRPLD 242 Query: 244 KEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYA 303 + I+++ KT + L+V E + GS+ +E+ I E F+LDAP R+ ++P +PYA Sbjct: 243 EVTILDSVRKTRRALVVDEGWRSGSLSAEIITRIIEQGFFELDAPPARVCSAEVP-IPYA 301 Query: 304 PTMEKYFMVNPDKVEAAMREL 324 +E+ + + AA R+L Sbjct: 302 RHLEEAALPQVPTIIAAARQL 322 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 324 Length adjustment: 28 Effective length of query: 299 Effective length of database: 296 Effective search space: 88504 Effective search space used: 88504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory