Align dihydrolipoyl dehydrogenase; EC 1.8.1.4 (characterized)
to candidate GFF2185 Psest_2230 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes
Query= CharProtDB::CH_004665 (470 letters) >FitnessBrowser__psRCH2:GFF2185 Length = 452 Score = 240 bits (612), Expect = 8e-68 Identities = 150/449 (33%), Positives = 235/449 (52%), Gaps = 20/449 (4%) Query: 11 DTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALINAGHRYENAKH 70 D VIGAG GG AA AA G +V V E LGG C+NVGC+P K L+ H E+ Sbjct: 6 DLFVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHYAEDIGQ 65 Query: 71 SDDMGITAENVTVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVM 130 + G T + T D+ ++ K + +L G +L + V +++ A VD+++V V Sbjct: 66 AQGYGWTIDGATFDWNRLIANKDREIQRLNGIYRSILVDSGVTLLQAHARLVDAHTVEV- 124 Query: 131 DENSAQTYTFKNAIIATGSRPIELPNFKYSERVLNSTGALALKEIPKKLVVIGGGYIGTE 190 + Y+ ++ +IATG P +P E + S A L+ +P++++V+GGGYI E Sbjct: 125 ---EGKRYSAEHILIATGGWP-HVPEIAGREHAITSNEAFYLESLPRRVLVVGGGYIAVE 180 Query: 191 LGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGNVEIHTNAMAKGVEERPDG 250 + + G + +L G+ L GF+ + + + KKG V++ NA ++++PDG Sbjct: 181 FASIFHGCGADTKLLYRGELFLRGFDGSLRDHLKDEMIKKG-VDLQFNADIVHIDKQPDG 239 Query: 251 -VTVTFEVKGEEKTVDADYVLITVGRRPNTDELGLEQVGIEMTDRGIVKTDKQCRTNVPN 309 + T E + +T++AD + GRRP D LGLEQ G+ + RG + D + RT+V + Sbjct: 240 SLLATLE---DGRTLEADCIFYATGRRPMLDNLGLEQAGVALDARGFIAVDDEYRTSVSS 296 Query: 310 IYAIGDIIEGPPLAHKASYEGKIAAEAI--AGEPAEIDYLGIPAVVFSEPELASVGYTEA 367 I AIGD+I L A EG A + + ++DY IP VFS P +A+VG TE Sbjct: 297 ILAIGDVIGRIQLTPVALAEGMAVARRLFKPEQYRKVDYATIPTAVFSLPNMATVGLTEE 356 Query: 368 QAKEEGLDIVAAKFPFAANGRALSLNETD----GFMKLITRKEDGLVIGAQIAGASASDM 423 +A+E+G + F + R + L TD MKL+ E V+G +AG A ++ Sbjct: 357 EAREKGYKVTI----FESRFRPMKLTMTDSLERSLMKLVVDAETDRVLGCHMAGPEAGEI 412 Query: 424 ISELSLAIEGGMTAEDIAMTIHAHPTLGE 452 I L++A++ G T + T+ HPT E Sbjct: 413 IQGLAVALKAGATKQVFDETMGIHPTAAE 441 Lambda K H 0.314 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 452 Length adjustment: 33 Effective length of query: 437 Effective length of database: 419 Effective search space: 183103 Effective search space used: 183103 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory