Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate GFF1289 Psest_1322 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases
Query= reanno::pseudo3_N2E3:AO353_05985 (294 letters) >FitnessBrowser__psRCH2:GFF1289 Length = 295 Score = 152 bits (385), Expect = 7e-42 Identities = 92/290 (31%), Positives = 144/290 (49%), Gaps = 7/290 (2%) Query: 3 IAFIGLGNMGAPMARNLIKAGHSLNLVDLNKAVLAELAQLGGTISATAREAAQGAELVIT 62 +AF G+G MG PM R L+ AG+ L + + + L LG AT E A++V+ Sbjct: 7 LAFAGIGLMGLPMCRRLLAAGYRLVVWNRSPEKCEPLVALGARAVATPAELCAEADIVLL 66 Query: 63 MLPAAVHVRSVWLGEDGVLAGIAKGVPAVDCSTIDPQTARDVAAAAA-KQGVAMADAPVS 121 L VR V G+ G+ G G VD S+++P RD+AA + G+ DAPVS Sbjct: 67 CLADTAAVREVLFGKGGIAEGGKAGKLLVDHSSLEPAATRDMAAELEFRSGMRWVDAPVS 126 Query: 122 GGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLAISM 181 GGT GA AG+L M G E ++PVL +G+ + H GEVG GQ+ K+CN +++A + Sbjct: 127 GGTPGAEAGSLVIMAGGRVEDVERVRPVLMNLGQRLTHMGEVGAGQVTKVCNQMIVACNA 186 Query: 182 VGVSEAMALGDALGIDTQVLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFGAE 241 + ++E +AL + G+D +LA + ++ P E P + Sbjct: 187 LVIAEVVALAERAGVDASLLAPALAGGFADSRPLQILAPQMAASEFEPVK------WHVR 240 Query: 242 LMLKDLGLATEAARQAHQPVMLGAVAQQLYQAMSQRGEGGKDFSAIINSY 291 +LKDL A + +R+ L +A QL + +G +D + ++ Y Sbjct: 241 TLLKDLDTAVKLSREQGSATPLSGLAAQLMRLHGSQGNLERDPATLVQMY 290 Lambda K H 0.317 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 295 Length adjustment: 26 Effective length of query: 268 Effective length of database: 269 Effective search space: 72092 Effective search space used: 72092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory