Align NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate GFF1277 Psest_1310 ABC-type branched-chain amino acid transport system, permease component
Query= TCDB::Q8YY08 (377 letters) >FitnessBrowser__psRCH2:GFF1277 Length = 418 Score = 147 bits (371), Expect = 5e-40 Identities = 108/355 (30%), Positives = 165/355 (46%), Gaps = 72/355 (20%) Query: 15 FALFSLGLNLQWGFTGLINFGHIAFMTLGAYTTVLLS-LKGVPLFISAIVGAIFAALLGL 73 + + LGLN+ G GL++ G++ F +GAYT LLS GV + + + AAL G Sbjct: 123 YVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYTYALLSHYYGVGFWTALPIAGAMAALFGF 182 Query: 74 VIGFATLRLREDYLAIVTIGTGELIRLVVNNQDLPVGDTWVSGAFGVQSYPIPLSTEPNL 133 ++GF LRLR DYLAIVT+G GE+IR+++ N G G G+ P Sbjct: 183 LLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTSVTG-----GPNGISGIDKP------- 230 Query: 134 FFRLLMIGILTLLFAVTVFSLWRWIRNAQKLQLTDATDKTSSKQEIASRFGVGIILGLLA 193 T+F L R A+ +Q FGV Sbjct: 231 ----------------TLFGLSFDRRAAEGMQT------------FHEYFGVA------- 255 Query: 194 TAIYISGVITLYNYIPKA-GLMLVSLLVLAFVFWRLEYLVRSPWGRVLKAIREDEEIPKA 252 YN + K L L++LL++ + + L+R P GR +A+REDE +A Sbjct: 256 -----------YNSVNKVIFLYLIALLLVLLTLFVINRLLRMPIGRAWEALREDEIACRA 304 Query: 253 MGKNVFWYKLQSLMLGGAIAGIAGAFFAWQISAIYPDNFQPQLTFDSWIMVILGGAGNNI 312 +G N KL + LG AG AG+FFA + + P++F + +V+LGG G+ + Sbjct: 305 LGMNPTVIKLSAFTLGATFAGFAGSFFAARQGLVSPESFTFIESAIILAIVVLGGMGSQL 364 Query: 313 GSILGAVIYFAYDAITREVLPKIIPLDEARLGAFRIMCIGLILMVLMIWRPQGIL 367 G IL A++ + RE +R++ G +++++MIWRPQG+L Sbjct: 365 GVILAAIVMILLPELMRE------------FSEYRMLMFGALMVLMMIWRPQGLL 407 Lambda K H 0.328 0.145 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 418 Length adjustment: 31 Effective length of query: 346 Effective length of database: 387 Effective search space: 133902 Effective search space used: 133902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory