Align Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 (characterized)
to candidate GFF2304 Psest_2351 urea carboxylase
Query= SwissProt::Q5LUF3 (681 letters) >lcl|FitnessBrowser__psRCH2:GFF2304 Psest_2351 urea carboxylase Length = 1199 Score = 395 bits (1015), Expect = e-114 Identities = 233/557 (41%), Positives = 324/557 (58%), Gaps = 51/557 (9%) Query: 1 MFNKILIANRGEIACRVIKTARKMGISTVAIYSDADKQALHVQMADEAVHIGPPPANQSY 60 MF+K+LIANRG IACR+++T R + + +VA+YS+AD +LH+Q ADEA +G PA Q+Y Sbjct: 1 MFDKLLIANRGAIACRILRTLRGLDVKSVAVYSEADAASLHIQQADEAHSLGEGPAAQTY 60 Query: 61 IVIDKVMAAIRATGAQAVHPGYGFLSENSKFAEALEAEGVIFVGPPKGAIEAMGDKITSK 120 +V++K++ R TGA A+HPGYGFLSEN+ FAEA EA G+ FVGP + G K T++ Sbjct: 61 LVVEKILRIARETGASAIHPGYGFLSENAAFAEACEAAGIAFVGPTPEQLRMFGLKHTAR 120 Query: 121 KIAQEANVSTVPGYMGLIEDADEAVKISNQIGYPVMIKASAGGGGKGMRIAWNDQEAREG 180 +A++ V + G L++ +A+ + Q+GYPVM+K++AGGGG GMR+ + E E Sbjct: 121 ALAKQRGVPMLEG-TELLDSLADALGAAEQVGYPVMLKSTAGGGGIGMRVCRSAAELAEA 179 Query: 181 FQSSKNEAANSFGDDRIFIEKFVTQPRHIEIQVLCDSHGNGIYLGERECSIQRRNQKVVE 240 F + K N+F D +FIEK++ + RH+E+QV D G I LG R+CS+QRRNQKV+E Sbjct: 180 FDAVKRLGQNNFSDAGVFIEKYIQRARHLEVQVFGDGRGEVIALGVRDCSVQRRNQKVLE 239 Query: 241 EAPSPFLDEATRRAMGEQAVALAKAVGYASAGTVEFIVDGQ-KNFYFLEMNTRLQVEHPV 299 E P+P L A+ E AV LAKAV Y SAGTVEF+ D + + FYFLE+NTRLQVEH V Sbjct: 240 ETPAPNLPAGMAEALCEAAVKLAKAVSYRSAGTVEFVYDAEAEQFYFLEVNTRLQVEHGV 299 Query: 300 TELITGVDLVEQMIRVAAGE--PLSITQGDVKLTGWAIENRLYAEDPYRGFLPSIGRLTR 357 TE + GVDLV MI +AAG+ PL +K +G +I+ RLYAEDP R F PS G LT Sbjct: 300 TEQVWGVDLVRWMIELAAGDLPPLVELARALKSSGHSIQARLYAEDPGRDFQPSPGLLTV 359 Query: 358 YRPPAETAAGPLLVNGKWQGDAPSGEA-AVRNDTGVYEGGEISMYYDPMIAKLCTWAPTR 416 D P G+ A+R DT V G EI Y+DPM+AKL TWAP R Sbjct: 360 V-------------------DFPKGDGKALRIDTWVEAGCEIPPYFDPMVAKLITWAPDR 400 Query: 417 AAAIEAMRIALDSFEVEGIGHNLPFLSAVMDHPKFISG--------------------DM 456 +A A+ ALD + G+ N +L ++ + F G Sbjct: 401 ESARAALDTALDETLLYGVESNRAYLRQILGYAPFAEGRPWTRCLEGLTYRATTFEVISA 460 Query: 457 TTAFIAEEYPE--GFEGVNLPET---DLRRVAAAAAAMHRVAEIRRTRVSGRMDNHERRV 511 T +++P G+ V +P + D R + A + + ++ M R Sbjct: 461 GTQTTVQDFPGRLGYWAVGVPPSGPMDNRALRLGNALLGNPEDAAGLEIT--MSGPILRF 518 Query: 512 GTEWVVTLQGADFPVTI 528 T+ VV + GA+ PV + Sbjct: 519 NTDAVVAITGAEIPVKL 535 Score = 35.4 bits (80), Expect = 2e-05 Identities = 20/61 (32%), Positives = 31/61 (50%) Query: 621 GLIVKVDVEVGQEVQEGQALCTIEAMKMENILRAEKKGVVAKINASAGNSLAVDDVIMEF 680 G + +V V G V+ G L +E+MKME L A GVV ++ A G+ + ++ Sbjct: 1137 GNLWQVSVAEGARVEAGDVLVILESMKMEIPLTAPVAGVVKEVRAQPGSPVRAGQRVVVI 1196 Query: 681 E 681 E Sbjct: 1197 E 1197 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1910 Number of extensions: 98 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 681 Length of database: 1199 Length adjustment: 43 Effective length of query: 638 Effective length of database: 1156 Effective search space: 737528 Effective search space used: 737528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory