Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate GFF3591 Psest_3658 spermidine/putrescine ABC transporter ATP-binding subunit
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__psRCH2:GFF3591 Length = 369 Score = 228 bits (582), Expect = 1e-64 Identities = 116/229 (50%), Positives = 162/229 (70%), Gaps = 3/229 (1%) Query: 9 INKFY-GTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIGGRDV 67 I K Y G + + D+NLDI GEF+ +GPSG GK+T L LAG E ++G I + GR + Sbjct: 16 IQKSYDGESLIVRDLNLDIRRGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEILLDGRAI 75 Query: 68 TTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGF-EPDLRKERIAEAARVLQLEDY 126 V P RD+ MVFQ+YAL+PHMTV EN+ F + V G +PD+ KER+ A ++QLE + Sbjct: 76 NNVPPHKRDMGMVFQNYALFPHMTVSENLAFPLSVRGMAKPDI-KERVKRALAMVQLEGF 134 Query: 127 LDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQLGAT 186 +R P QLSGGQ+QRVA+ RA+V P + L DEPL LD +LR QM++E++ LH++LG T Sbjct: 135 RNRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREQMQMEIKHLHERLGVT 194 Query: 187 MIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIG 235 ++YVTHDQ EA+TM+D++ V ++G+I+Q+ P LY KP + FVA F+G Sbjct: 195 VVYVTHDQGEALTMSDRVAVFHQGQIQQIEDPRTLYEKPVNTFVANFLG 243 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 369 Length adjustment: 29 Effective length of query: 309 Effective length of database: 340 Effective search space: 105060 Effective search space used: 105060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory