Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate GFF857 Psest_0871 ABC-type sugar transport systems, ATPase components
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__psRCH2:GFF857 Length = 371 Score = 194 bits (492), Expect = 4e-54 Identities = 105/277 (37%), Positives = 164/277 (59%), Gaps = 15/277 (5%) Query: 25 NVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEAVSSPRRVMMSPEKR 84 ++ + I+ G +GPSG GK+T LRLIAGLE+ TSG + DN+ V+ + P+ R Sbjct: 21 HIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLLIDNQRVND-----LPPKDR 75 Query: 85 GIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLSGVLNRYPKELS 144 + MVFQ++ALYP+MTV +N+AF LKLA V K +I+ +V+ V+E L L +L R PK+LS Sbjct: 76 SVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEILQLDKLLERKPKDLS 135 Query: 145 GGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTLIVSHDPA 204 GGQ QR AI R +V++PKV L DEP SNLDA +R R + ++ + + T + V+HD Sbjct: 136 GGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLHQRIRSTMIYVTHDQV 195 Query: 205 DIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTG--EINLIQAKIIENNAIIAN 262 + +A+K V+ G+ AQ+G P +Y YP +A G ++N ++ + I + Sbjct: 196 EAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMNFVEVRAISASPETVT 255 Query: 263 --------LKVPLNNMELKGQSNIVIGLRPDDLTLSD 291 L +P++ + + +G+RP+ + D Sbjct: 256 IELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVMPD 292 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 371 Length adjustment: 30 Effective length of query: 341 Effective length of database: 341 Effective search space: 116281 Effective search space used: 116281 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory