Align Alpha-ketoglutaric semialdehyde dehydrogenase 1; alphaKGSA dehydrogenase 1; 2,5-dioxovalerate dehydrogenase 1; 2-oxoglutarate semialdehyde dehydrogenase 1; KGSADH-I; Succinate-semialdehyde dehydrogenase [NAD(+)]; SSDH; EC 1.2.1.26; EC 1.2.1.24 (characterized)
to candidate GFF3587 Psest_3654 succinate-semialdehyde dehydrogenase
Query= SwissProt::Q1JUP4 (481 letters) >FitnessBrowser__psRCH2:GFF3587 Length = 488 Score = 354 bits (909), Expect = e-102 Identities = 193/465 (41%), Positives = 271/465 (58%), Gaps = 3/465 (0%) Query: 13 IDGEWVDAASGKTIDVVNPATGKPIGRVAHAGIADLDRALAAAQSGFEAWRKVPAHERAA 72 ++GEW +A SG ++ NPATG+ IG V + G + RA+ AAQ+ AWR + A ERAA Sbjct: 17 LNGEWCEADSGARTEIFNPATGELIGAVPNMGRGETRRAIEAAQAAQPAWRALTAKERAA 76 Query: 73 TMRKAAALVRERADAIAQLMTQEQGKPLTEARVEVLSAADIIEWFADEGRRVYGRIVPPR 132 +R+ L+ E + +A++MT EQGKPL EAR EV AA +EWFA+EG+R+YG ++P Sbjct: 77 RLRRWYELMLENQEDLARIMTAEQGKPLAEARGEVAYAASFLEWFAEEGKRLYGDVIPAH 136 Query: 133 NLGAQQTVVKEPVGPVAAFTPWNFPVNQVVRKLSAALATGCSFLVKAPEETPASPAALLR 192 + V KEPVG AA TPWNFP + RK ALA GC+ ++K +TP S AL Sbjct: 137 AGDKRILVQKEPVGVTAAITPWNFPSAMITRKAGPALAAGCAMVLKPAPQTPFSALALAA 196 Query: 193 AFVDAGVPAGVIGLVYGDPA---EISSYLIPHPVIRKVTFTGSTPVGKQLASLAGLHMKR 249 AG+PAG++ ++ D A E+ + L +P++RK++FTGST VG +L +K+ Sbjct: 197 LAERAGIPAGLLSVITADAATSREVGAELCENPIVRKLSFTGSTAVGIKLMQQCAPTLKK 256 Query: 250 ATMELGGHAPVIVAEDADVALAVKAAGGAKFRNAGQVCISPTRFLVHNSIRDEFTRALVK 309 ++ELGG+AP IV +DAD+ AV+ A +K+RNAGQ C+ R V + I D F L Sbjct: 257 LSLELGGNAPFIVFDDADLDAAVEGAMISKYRNAGQTCVCANRIYVQDGIYDAFVDKLSA 316 Query: 310 HAEGLKVGNGLEEGTTLGALANPRRLTAMASVIDNARKVGASIETGGERIGSEGNFFAPT 369 LKVGNG EEG T G L + + + + +A GA++ GG+ GNFF PT Sbjct: 317 AVARLKVGNGAEEGVTTGPLIDAAAVAKVQRHLQDALDKGATLLAGGKPHALGGNFFEPT 376 Query: 370 VIANVPLDADVFNNEPFGPVAAIRGFDKLEEAIAEANRLPFGLAGYAFTRSFANVHLLTQ 429 ++ V + V E FGP+A + F +E I +AN FGLA Y + R + V + + Sbjct: 377 LVGGVTSEMAVAREETFGPLAPLFRFRDEDEVIRQANDTEFGLAAYFYARDLSRVFRVAE 436 Query: 430 RLEVGMLWINQPATPWPEMPFGGVKDSGYGSEGGPEALEPYLVTK 474 LE GM+ IN PFGG+K SG G EG L+ Y+ K Sbjct: 437 ALEYGMVGINTGVISTEVAPFGGMKASGLGREGSKYGLDEYVEIK 481 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 638 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 481 Length of database: 488 Length adjustment: 34 Effective length of query: 447 Effective length of database: 454 Effective search space: 202938 Effective search space used: 202938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory