Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate GFF3163 Psest_3223 Lactate dehydrogenase and related dehydrogenases
Query= curated2:B1L765 (332 letters) >FitnessBrowser__psRCH2:GFF3163 Length = 319 Score = 171 bits (433), Expect = 2e-47 Identities = 105/280 (37%), Positives = 164/280 (58%), Gaps = 14/280 (5%) Query: 39 IIERVKDCD-ALVSLLTDPIDAEVFEAAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTP 97 I+ER++ A+V+ ++ + AE A P+L+++ A G +NID++ A +RGI V+N Sbjct: 41 IVERLQGAQVAIVNKVS--LTAETLAACPELKLILVSATGVNNIDLQAARERGIVVSNCQ 98 Query: 98 GVLTETTADFAFALLMAAARRVVEADRYVREGKWKVAWHPMMMLGYDVY---GRTLGIVG 154 T T A LL+A A R+ + V G+W+ + +L + + G+TLG++G Sbjct: 99 AYGTPTVAQHTLMLLLALATRLPDYQAAVARGRWQESGQ-FCLLDFPIVELEGKTLGLLG 157 Query: 155 MGRIGAAVARRAKGFGMRILYYDSIRREDFEKELGVEYVPLEKLLEESDFVSLHVPLTEE 214 G +G+AVAR A+ FGMR+L + R + L L++LL + D ++LH PLTE+ Sbjct: 158 HGELGSAVARLAEAFGMRVLVGNLPGRPKRPERLD-----LDELLPQVDALTLHCPLTEQ 212 Query: 215 TYHMIGEEQLRRMKRTAILVNTSRGKVVDQKALYKALKEGWIAGAGLDVFEQEPIPPDDP 274 T ++IG +L+ MK TA L+N +RG +VD++AL AL+ G + GA DV EP D+P Sbjct: 213 TRNLIGARELQLMKPTAFLINAARGGLVDEQALADALRRGHLGGAATDVLTSEPPRDDNP 272 Query: 275 LL--KLENVVLAPHAASASHETRSRMAEMVAENLIAFKRG 312 LL L +++ PH+A S E R R+ +AEN AF G Sbjct: 273 LLAPDLPRLIITPHSAWGSREARQRIVAQLAENATAFFAG 312 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 319 Length adjustment: 28 Effective length of query: 304 Effective length of database: 291 Effective search space: 88464 Effective search space used: 88464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory