Align xylonate dehydratase (EC 4.2.1.82) (characterized)
to candidate GFF835 Psest_0849 6-phosphogluconate dehydratase
Query= BRENDA::P39358 (655 letters) >lcl|FitnessBrowser__psRCH2:GFF835 Psest_0849 6-phosphogluconate dehydratase Length = 608 Score = 167 bits (424), Expect = 1e-45 Identities = 149/480 (31%), Positives = 226/480 (47%), Gaps = 47/480 (9%) Query: 119 CDGRTQGTTGMFDSLPYRNDASMVMR-RLIRSLPDAKAVIGVASCDKGLPATMMALAAQH 177 CDG TQG GM ++ R +M L +L DA ++G+ CDK +P ++ Sbjct: 112 CDGVTQGEPGMELAIASREVIAMSTAVALSHNLFDAALLLGI--CDKIVPGLLIGALRFG 169 Query: 178 NIATVLVPGGATLPAKDGEDNGKVQTIGARFANGELSLQDARRAGCKACASSGGGCQFLG 237 ++ V VP G P G N + R+A G+ S + A +A S G C F G Sbjct: 170 HLPAVFVPAG---PMPSGLANKDKAAVRQRYAEGKASRDELLAAEMQAYHSPGT-CTFYG 225 Query: 238 TAGTSQVVAEGLGLAIPHSALAPSGEPVWREIARASARAALNLSQKG---ITTREILTDK 294 TA T+Q++ E +GL +P S+ G P+ + +AR L+ +G E++ ++ Sbjct: 226 TANTNQMLMEVMGLHLPGSSFVNPGTPLRDALTAEAARQVTRLTPQGGCFTPLGELVDER 285 Query: 295 AIENAMTVHAAFGGSTNLLLHIPAIAHQAGCHIPTVDDWIRINKRVPRLVSVLPNGPVYH 354 + NA+ A GGSTN LH+PAIA AG + T D ++ VP L V PNGP Sbjct: 286 VLVNAIVALHATGGSTNHTLHMPAIAQAAGIQL-TWQDMADLSAVVPTLARVYPNGPA-- 342 Query: 355 PTVNAF-MAGGVPEVMLHLRSLGLLHEDVMTVTGSTLKENLDWWEHSERRQRFKQLLLDQ 413 +N F AGGV ++ L + GLLHEDV TV G L + + + + Sbjct: 343 -DINHFHAAGGVAVLVRELLAAGLLHEDVHTVMG----RGLSRYTQEPFLEGGRLTWREG 397 Query: 414 EQINADEVIMSPQQAKARGLTSTITFPVGNIAPEGSVIKSTAIDPSMIDEQGIYYHKGV- 472 + DE ++ P A+ + GN+ V+K +A+ P H+ V Sbjct: 398 AAASLDESLLRP-VARPFSAEGGLRVMSGNLG--RGVMKVSAVAPE---------HRVVE 445 Query: 473 --AKVYLSEKSAIYDIKHDKIKAGDILVIIGVGPSGTGMEETYQVTSALKHL-SYGKHVS 529 A+V+ + + K +++ + V+ GP GM E +++T L L G V+ Sbjct: 446 APARVFADQLELVEAFKAGELERDVVAVVRFQGPRANGMPELHKLTPYLGLLQDRGFKVA 505 Query: 530 LITDARFSGVS--TGACIGHVGPEALAGGPIGKLRTGDL---------IEIKIDCRELHG 578 L+TD R SG S A I HV PEA+ GGP+ ++R GDL +E+ +D EL G Sbjct: 506 LVTDGRMSGASGKVPAAI-HVCPEAIDGGPLARVRDGDLLRVDGQAGVLEVLVDAAELAG 564 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 951 Number of extensions: 51 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 608 Length adjustment: 38 Effective length of query: 617 Effective length of database: 570 Effective search space: 351690 Effective search space used: 351690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory