Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate GFF2105 Psest_2148 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= BRENDA::B8H1Z0 (248 letters) >FitnessBrowser__psRCH2:GFF2105 Length = 285 Score = 105 bits (263), Expect = 8e-28 Identities = 75/248 (30%), Positives = 120/248 (48%), Gaps = 16/248 (6%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRC- 67 L+GK +ITGG SGIG + FAR+GA+V L + +AE + + +RC Sbjct: 39 LEGKTAIITGGDSGIGRSVAVLFAREGADVAILYLDQHQ----DAEETRTVVEQYGRRCL 94 Query: 68 ----DLMNLEAIKAVFAE----IGDVDVLVNNAGNDD-RHKLADVTGAYWDERINVNLRH 118 D+ + + + V E G +D+LVNNA + KL D++ W++ N+ Sbjct: 95 TFAGDVADRDVCRKVIDETLAAFGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFG 154 Query: 119 MLFCTQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDD 178 M T+AV P + K G ++IN S++ + G L+ Y K I TR+L+ L Sbjct: 155 MFQMTKAVLPHLGK--GASIINTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERG 212 Query: 179 IRVTCVVPGNVKTKRQEKWYTPEGEAQIVAAQCLKGRIVPENVAALVLFLASDDASLCTG 238 IRV V PG + T + + A+ + +K P+ VA ++LAS DA+ +G Sbjct: 213 IRVNGVAPGPIWTPLISSTFDADEVAEFGSNTPMKRPGQPDEVAPAYVYLASSDAAYVSG 272 Query: 239 HEYWIDAG 246 ++ G Sbjct: 273 QVIHVNGG 280 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 285 Length adjustment: 25 Effective length of query: 223 Effective length of database: 260 Effective search space: 57980 Effective search space used: 57980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory