GapMind for catabolism of small carbon sources

 

Protein PfGW456L13_876 in Pseudomonas fluorescens GW456-L13

Annotation: FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_876

Length: 245 amino acids

Source: pseudo13_GW456_L13 in FitnessBrowser

Candidate for 16 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 54% 100% 264.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-Glucosamine, putative ATPase component (characterized) 57% 94% 259.6 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 53% 92% 246.1 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 53% 92% 246.1 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 49% 99% 228.4 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 49% 99% 228.4 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-histidine catabolism PA5503 med Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 40% 74% 174.9 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-tryptophan catabolism ecfA2 med Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 42% 80% 149.8 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 39% 75% 135.6 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-alanine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-leucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-proline catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-serine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-threonine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 32% 95% 115.2 Amino acid ABC transporter ATP binding protein, component of Hydroxy L-proline uptake porter, HprABC 56% 265.0

Sequence Analysis Tools

View PfGW456L13_876 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPLLRISALHKYYGDHHVLKGIDLSIEEGQVVAIIGRSGSGKSTLLRTLNGLESINDGVI
EVDGEYLDAARADLRSLRQKVGMVFQQFNLFPHLTVGENVMLAPQVVQKVPKAKAAELAR
QMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCDEITSALDPELVNEVLSV
VRQLAREGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDPKVLFANPQTAELANFIGT
VEAVG

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory