Align Alpha-ketoglutarate permease of the major facilitator superfamily protein (characterized, see rationale)
to candidate PfGW456L13_2351 Permeases of the major facilitator superfamily
Query= uniprot:D8J257 (457 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2351 Length = 436 Score = 211 bits (536), Expect = 5e-59 Identities = 125/412 (30%), Positives = 209/412 (50%), Gaps = 19/412 (4%) Query: 22 AILGASSGNLVEWFDFYVYSFCA-IYFAPAFFPKGDPTSQLLNTAGVFAAGFLMRPIGGW 80 A A G ++EW+DFY+Y+ A + F FFP D + G FA GF RP+GG Sbjct: 12 AAAAAFIGTMIEWYDFYIYATAAALVFGALFFPSDDKLFSTMAAFGTFAVGFFARPLGGI 71 Query: 81 LFGRIADKHGRKTSMLISVLMMCGGSLAVAVMPTYATIGAWAPALLLLARLFQGLSVGGE 140 +FG I D+ GRK S++I++LMM ++ + ++PTYA IGA AP LL+L R+ QG++VGGE Sbjct: 72 VFGHIGDRIGRKKSLIITLLMMGVVTVCIGLLPTYAQIGAAAPVLLILLRIVQGIAVGGE 131 Query: 141 YGTSATYMSEVAPNGRRGFFASFQYVTLIGGQLLAVLVLFGMQQWLTKAELMAWGWRVPF 200 +G + E AP GRR FFASF + G +L++L F L + +LM+WGWR+PF Sbjct: 132 WGGAVLMAGEHAPKGRRNFFASFAQLGSPAGLILSLLA-FSAVTRLPEEDLMSWGWRLPF 190 Query: 201 VLGAVGALVAMYLRSSLAETS--------SAGARKKKDAGTLKGLLQHKRAFLNVVGFTA 252 + ++ LV + +R + E+ ++ ++K+ A ++ L R L +G Sbjct: 191 LASSLLLLVGLAIRLGVNESPEFLASRELASKNKRKEQAPVMEVLRTAWRPLLLCIGANT 250 Query: 253 GGSLMFYTFTTYMQKYLVNTAGMDPKVANGVMTGALFVYMILQPIFGAISDKIGRRNSML 312 G Y T+M Y + + + + +QP+ +++KIG + Sbjct: 251 LGIAGVYFTNTFMIAYTTQQLELPRSLILECLFVVAIIQFCIQPLAAWVAEKIGATRFLC 310 Query: 313 CFAFFGMVGTFPILHFLKDVSSPGVAMALAILALTIVSFYTSISGLIKAEMFPPEVRALG 372 + M +P+ + +P + + +A+ + + SFY I+G + MF VR Sbjct: 311 LVSLLAMASPYPMFVLVSSAQAPLIILGIALAVVCMASFYAVIAGYVSG-MFETRVRYTA 369 Query: 373 VGLSYAVGNAIFGGSAEFVALSLKSAGI-----ESAFYWYVSA---LCLVAL 416 + L+Y + A+ GG + L + + FY ++A LC+++L Sbjct: 370 ISLAYQICGAVAGGLTPLIGTLLAHRFVGQWWPMAVFYSLIAATSLLCVLSL 421 Lambda K H 0.325 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 528 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 436 Length adjustment: 33 Effective length of query: 424 Effective length of database: 403 Effective search space: 170872 Effective search space used: 170872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory