Align 4-hydroxybenzoyl-CoA reductase subunit gamma; 4-HBCR subunit gamma; EC 1.3.7.9 (characterized)
to candidate PfGW456L13_3926 Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs
Query= SwissProt::O33818 (161 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3926 Length = 179 Score = 98.2 bits (243), Expect = 6e-26 Identities = 61/156 (39%), Positives = 90/156 (57%), Gaps = 18/156 (11%) Query: 5 LRLTLNGRAREDL-VPDNMLLLDYLRETVGLTGTKQGCDGGECGACTVLVDDRPRLA--- 60 L+LTLNG++ + +PD++ ++DYL E LTG++ GC G C AC V+VD+ + Sbjct: 6 LQLTLNGQSVGPVDIPDDLPMIDYLHEYKNLTGSRLGCGQGICHACVVIVDNPDGTSEEV 65 Query: 61 --CSTLAHQVAGKKVETVESLAT---QGTLSKL---QAAFHEKLGTQCGFCTPGMIMASE 112 C T AH GKKV T+E AT QG +++L Q F ++ QC +C PG + A+ Sbjct: 66 RTCITGAHYFEGKKVRTIEGHATCDEQGKVTELNPIQQRFVDEFAFQCSYCAPGFVNAAT 125 Query: 113 AL---LRKNP---SPSRDEIKAALAGNLCRCTGYVR 142 L L++ P S I+ +L ++CRCTGYVR Sbjct: 126 VLVEKLQRQPIVKSQLEKVIEDSLGHHICRCTGYVR 161 Lambda K H 0.318 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 161 Length of database: 179 Length adjustment: 18 Effective length of query: 143 Effective length of database: 161 Effective search space: 23023 Effective search space used: 23023 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory