Align 2-oxopent-4-enoate hydratase subunit (EC 4.2.1.80) (characterized)
to candidate PfGW456L13_2504 4-oxalocrotonate decarboxylase (EC 4.1.1.77)
Query= metacyc::MONOMER-3403 (222 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2504 Length = 263 Score = 278 bits (710), Expect = 9e-80 Identities = 140/222 (63%), Positives = 170/222 (76%), Gaps = 1/222 (0%) Query: 1 MDKTLINELGDELYQAMVQRETVTPLTSRGFDISVEDAYHISLRMLERRLAAGERVIGKK 60 M L E G+ELYQA++ T+ PLT R IS+EDAYHISL +ERR+AAG++++GKK Sbjct: 1 MSVQLRREFGEELYQALLSGSTLAPLTERWPSISIEDAYHISLYAIERRVAAGDQIVGKK 60 Query: 61 IGVTSKAVQNMLGVHQPDFGYLTDAMVYNSGEAMPIS-EKLIQPRAEGEIAFILKKDLMG 119 IGVTS AVQ ML VHQPDFG++T M ++ + +S KLIQPRAEGEIAF LK DL+G Sbjct: 61 IGVTSAAVQQMLNVHQPDFGFITRQMSFDDDAQISLSANKLIQPRAEGEIAFKLKHDLVG 120 Query: 120 PGVTNADVLAATECVIPCFEVVDSRIQDWKIKIQDTVADNASCGLFVLGDQAVSPRQVDL 179 PG+T ADVLAATE V+PCFE+VDSRI DW+I+IQDTVADNASCG+FVLGD V PR++DL Sbjct: 121 PGITEADVLAATEYVMPCFEIVDSRIHDWRIRIQDTVADNASCGVFVLGDSKVDPRELDL 180 Query: 180 VTCGMLVEKNGQLLSTGAGAAALGSPVNCVAWLANTLGHFGI 221 M V KN + LS G G+A G+P+ VAWLANTLG FGI Sbjct: 181 PNLRMRVFKNAEPLSEGLGSAVQGNPLTAVAWLANTLGAFGI 222 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 263 Length adjustment: 23 Effective length of query: 199 Effective length of database: 240 Effective search space: 47760 Effective search space used: 47760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory