Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2 (characterized, see rationale)
to candidate PfGW456L13_4586 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)
Query= uniprot:A0A0C4YE08 (470 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 Length = 454 Score = 445 bits (1144), Expect = e-129 Identities = 231/445 (51%), Positives = 296/445 (66%), Gaps = 4/445 (0%) Query: 5 SRLTDPMFGSAATLAAFSDTATVQRMLDFEAALARAEASCGVIPADAAEAIAATCRAGEI 64 ++L D F + F D VQ MLDFEAALARAEA G+IP+ A I A CRAG Sbjct: 7 NQLFDAYFTARDMREVFCDQGRVQAMLDFEAALARAEARVGMIPSSAVAPIEAACRAGLY 66 Query: 65 DFDALAAAAVAGGNLAIPLVRQLTARVAARDAQAARYVHWGATSQDAIDTGMVLQLREAL 124 DF L A GN AIPLV+ L ++AA DA+A RYVH GATSQD +D+G+VLQLR AL Sbjct: 67 DFAMLGEAIATAGNSAIPLVKALGKQIAATDAEAERYVHLGATSQDVMDSGLVLQLRRAL 126 Query: 125 QAVDADLKALGHACAALAAQHRDTPMVARTWLQHALPTTFGLKAAGWLDALRRDLRRLDA 184 + +++DL LG A+ A ++ TP+ RTWLQHA P T G+K AGWL A+ R +RL Sbjct: 127 ELIESDLAQLGQTLASQAQRYATTPLAGRTWLQHATPVTLGMKIAGWLGAVTRSRQRLAE 186 Query: 185 ARAQAATLQFGGAAGTLASLGAAAPAVATALGSALSLAVAPTPWHAYRDRMVEVATTLGM 244 + + LQFGGA+GTLA+LG A +A AL L L + PWH RDR+VE LG+ Sbjct: 187 LKPRLLVLQFGGASGTLAALGEQAMPIAQALAEELQLTLPDQPWHTQRDRVVEFGAALGL 246 Query: 245 LTGSLGKIARDVSLMMQTEVAEVAEPTGPGRGGSSTMPHKRNPVGCAAVLTAAVRVPPLV 304 + GSLGK+ RD+SL+MQTE AEV EP+ PG+GGSSTMPHKRNPVG A ++ AA RVP L+ Sbjct: 247 IAGSLGKLGRDISLLMQTEAAEVFEPSAPGKGGSSTMPHKRNPVGAAVLIGAATRVPGLL 306 Query: 305 ATMLAGMVQEHERALGGWQAEWDTLPQIVTLAAGALRQMLEVVGGLQVDAARMRANLGVT 364 +T+ + M QEHER+LG W AEW+TLP+I L +G+L Q L +V GL+VDA RM NL +T Sbjct: 307 STLFSAMPQEHERSLGLWHAEWETLPEICCLVSGSLHQALLIVQGLEVDAERMARNLDLT 366 Query: 365 HGLILAEAAMLELGGKIGRLPAHHLVEGACRRAVAEGTTLRQALGATLAEDAAHAGLMDA 424 GL+LAEA + L ++GR AHHL+E C+RAVAE LR LG ++ + A Sbjct: 367 QGLVLAEAVSIVLAQRVGRNTAHHLLEQCCKRAVAEQRHLRAVLG----DEPQVTAELSA 422 Query: 425 AALDRVCDPANYAGQAAGFVDAVLA 449 A LD + D A+Y GQA +V+ +A Sbjct: 423 AELDHLLDSAHYLGQAKTWVERAVA 447 Lambda K H 0.319 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 454 Length adjustment: 33 Effective length of query: 437 Effective length of database: 421 Effective search space: 183977 Effective search space used: 183977 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate PfGW456L13_4586 (3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02426.hmm # target sequence database: /tmp/gapView.22647.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02426 [M=338] Accession: TIGR02426 Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-144 466.3 10.2 3.4e-144 465.9 10.2 1.2 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 3-carboxy-cis,cis-muconate cyclo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.9 10.2 3.4e-144 3.4e-144 1 338 [] 9 352 .. 9 352 .. 0.99 Alignments for each domain: == domain 1 score: 465.9 bits; conditional E-value: 3.4e-144 TIGR02426 1 lldglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaae 55 l+d++f++ +++e+f d++r++amld+Eaalara+a+vG+ip++a++ i+aa+++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 9 LFDAYFTARDMREVFCDQGRVQAMLDFEAALARAEARVGMIPSSAVAPIEAACRA 63 7899*************************************************** PP TIGR02426 56 lalDlealaeaaaeagnvviplvkalrkavae...eaaryvHlGaTSQDviDTal 107 +D + l ea+a+agn++iplvkal k++a+ ea+ryvHlGaTSQDv+D +l lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 64 GLYDFAMLGEAIATAGNSAIPLVKALGKQIAAtdaEAERYVHLGATSQDVMDSGL 118 ******************************999999******************* PP TIGR02426 108 mLqlrdaldllladlerlaeaLaelaarhrdtpltarTllQqAvpttvglkaagw 162 +Lqlr+al+l++ dl++l ++La++a+r + tpl +rT+lQ+A+p+t+g+k+agw lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 119 VLQLRRALELIESDLAQLGQTLASQAQRYATTPLAGRTWLQHATPVTLGMKIAGW 173 ******************************************************* PP TIGR02426 163 laavlrardrlealrtealalqfGGAaGtlaalekkglavaealAaelgLeapal 217 l av+r+r+rl++l+ ++l+lqfGGA+Gtlaal+++++ +a+alA+el+L++p + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 174 LGAVTRSRQRLAELKPRLLVLQFGGASGTLAALGEQAMPIAQALAEELQLTLPDQ 228 ******************************************************* PP TIGR02426 218 pWhtqrdriaelaaaLalvagalgkiaqDvallaqtevgevle.agg..GGSSam 269 pWhtqrdr++e++aaL+l+ag+lgk+++D++ll+qte++ev+e +++ GGSS+m lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 229 PWHTQRDRVVEFGAALGLIAGSLGKLGRDISLLMQTEAAEVFEpSAPgkGGSSTM 283 *******************************************766689****** PP TIGR02426 270 pHKrNPvaaevlaaaarrapglvatLfaalaqedeRsaggWhaeWetLrelvalt 324 pHKrNPv+a+vl++aa+r+pgl++tLf+a++qe+eRs+g WhaeWetL+e+++l+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 284 PHKRNPVGAAVLIGAATRVPGLLSTLFSAMPQEHERSLGLWHAEWETLPEICCLV 338 ******************************************************* PP TIGR02426 325 agalrqaaellegl 338 +g+l+qa +++gl lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4586 339 SGSLHQALLIVQGL 352 *******9999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (338 nodes) Target sequences: 1 (454 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.67 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory