Align Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate PfGW456L13_4585 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)
Query= reanno::pseudo3_N2E3:AO353_17230 (266 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 Length = 263 Score = 462 bits (1188), Expect = e-135 Identities = 228/262 (87%), Positives = 245/262 (93%) Query: 1 VGFVQLADGELKYQLDGPEHAPVLVLSNSLGTNLHMWDVQIPAFTKHFRVLRFDTRGHGR 60 V FVQLA+GEL YQLDGP APVLVLSNSLGT+LHMWD QIPAF+KHFRVLRFDTRGHG+ Sbjct: 1 VAFVQLAEGELHYQLDGPVDAPVLVLSNSLGTDLHMWDAQIPAFSKHFRVLRFDTRGHGQ 60 Query: 61 SLVTPGPYSIEQLGRDVLALLDALNIERAHFCGLSMGGLIGQWLGINAGERLHKLVVCNT 120 SLVTPGPYSIEQLGRDVLALLDAL+IERAHFCGLSMGGLIGQWLGINAG+RL++L+VCNT Sbjct: 61 SLVTPGPYSIEQLGRDVLALLDALHIERAHFCGLSMGGLIGQWLGINAGDRLNQLIVCNT 120 Query: 121 AAKIGDPSVWNPRIETVLRDGPAAMVALRDASIARWFTPDFAQANPAVAKQITDMLAATS 180 AAKIGDPSVWNPRIE VLRDG AAMVALRDASIARWFTPDF++ANPA AKQITDMLAATS Sbjct: 121 AAKIGDPSVWNPRIEMVLRDGQAAMVALRDASIARWFTPDFSEANPAAAKQITDMLAATS 180 Query: 181 PQGYAANCAAVRDADFREQLASITVPTLVIAGTEDAVTPPSGGRFIQERVRGAEYAEFYA 240 P+GYAANCAAVRDADFR+QL+SI P LVIAGTEDAVTPPSGG FIQE V GAEYAEFYA Sbjct: 181 PEGYAANCAAVRDADFRDQLSSIKAPLLVIAGTEDAVTPPSGGHFIQEHVPGAEYAEFYA 240 Query: 241 AHLSNVQAGSAFSDRVLSFLLA 262 AHLSNVQAG+ FS+ VL+FL A Sbjct: 241 AHLSNVQAGADFSECVLAFLKA 262 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 263 Length adjustment: 25 Effective length of query: 241 Effective length of database: 238 Effective search space: 57358 Effective search space used: 57358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate PfGW456L13_4585 (Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24))
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.936.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-109 350.5 0.0 2.8e-109 350.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 Beta-ketoadipate enol-lactone hy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 350.3 0.0 2.8e-109 2.8e-109 2 251 .] 11 261 .. 10 261 .. 0.99 Alignments for each domain: == domain 1 score: 350.3 bits; conditional E-value: 2.8e-109 TIGR02427 2 lhyrlegaeadkpvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvp 56 lhy+l+g+ d+pvlvl+nSLGtdl++wd++++a++k+frvlr+D+rGHG+S v+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 11 LHYQLDGPV-DAPVLVLSNSLGTDLHMWDAQIPAFSKHFRVLRFDTRGHGQSLVT 64 9********.********************************************* PP TIGR02427 57 egpysiedladdvlallDalgiekaavcGlSlGGliaqaLaarrpdrvealvlsn 111 gpysie+l++dvlallDal+ie+a++cGlS+GGli+q+L+++++dr+++l+++n lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 65 PGPYSIEQLGRDVLALLDALHIERAHFCGLSMGGLIGQWLGINAGDRLNQLIVCN 119 ******************************************************* PP TIGR02427 112 taakigtaesWeaRiaavraeG...laaladavlerwFtpafreaepaelelvrn 163 taakig++++W++Ri+ v ++G + al+da+++rwFtp+f ea+pa+++++++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 120 TAAKIGDPSVWNPRIEMVLRDGqaaMVALRDASIARWFTPDFSEANPAAAKQITD 174 **********************999999*************************** PP TIGR02427 164 mlveqppegYaatcaAirdadlrerleeiavPtlviaGdeDgstPpelvreiadl 218 ml++++pegYaa+caA+rdad+r++l++i++P+lviaG+eD++tPp+ + i+++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 175 MLAATSPEGYAANCAAVRDADFRDQLSSIKAPLLVIAGTEDAVTPPSGGHFIQEH 229 ******************************************************* PP TIGR02427 219 vpgarfaeieeaaHlpnleqpeafaallrdflk 251 vpga++ae++ aaHl+n+++++ f++ + +flk lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 230 VPGAEYAEFY-AAHLSNVQAGADFSECVLAFLK 261 **********.********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (263 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.92 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory