Align 4-hydroxybenzoate transporter PcaK (characterized)
to candidate PfGW456L13_1500 benzoate MFS transporter BenK
Query= SwissProt::Q51955 (448 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1500 Length = 447 Score = 275 bits (703), Expect = 2e-78 Identities = 155/438 (35%), Positives = 243/438 (55%), Gaps = 4/438 (0%) Query: 10 KSLDVQSFINQQPLSRYQWRVVLLCFLIVFLDGLDTAAMGFIAPALSQEWGIDRASLGPV 69 + +DV I+ +R+ W V+ C LI+ DG D G + P L +EWG+ G + Sbjct: 2 RKIDVHEVIDNARFNRFHWMVLFWCALIIIFDGYDLVIYGVVLPMLMKEWGLSPLQAGAL 61 Query: 70 MSAALIGMVFGALGSGPLADRFGRKGVLVGAVLVFGGFSLASAYATNVDQLLVLRFLTGL 129 S AL GM+FGAL GPL+DR GRK + V++F GF++ + +A N + + RF+ GL Sbjct: 62 GSYALFGMMFGALFFGPLSDRIGRKKAITICVMLFSGFTVLNGFARNPTEFGLCRFIAGL 121 Query: 130 GLGAGMPNATTLLSEYTPERLKSLLVTSMFCGFNLGMAGGGFISAKMIPAYGWHSLLVIG 189 G+G MPN L++EY P++++S LV MF G+++G + +IP++GW S+ + Sbjct: 122 GIGGVMPNVVALMNEYAPKKIRSTLVAIMFSGYSVGGMLSAGLGIVLIPSFGWQSVFYV- 180 Query: 190 GVLPLLLALVLMVWLPESARFLVVRNRGTDKIRKTLSPIAPQVVAEAGSFSVPEQKAVAA 249 VLPLLL ++M +LPES F++ + R ++ R L I P VA+ S + + Sbjct: 181 AVLPLLLLPLIMYFLPESVGFMLRQGR-NEEARNILQRIDPAYVAQT-SDQLQMAEVKGT 238 Query: 250 RSVFAVIFSGTYGLGTMLLWLTYFMGLVIVYLLTSWLPTLMRDSGASMEQAAFIGALFQF 309 + +F L T++LWL +F L++VY L+SWLP LM ++G S+ + + F Sbjct: 239 GTPVLQLFREGRALRTLMLWLAFFCCLLMVYALSSWLPKLMANAGYSLGSSLSFLLVLNF 298 Query: 310 GGVLSAVGVGWAMDRYNPHKVIGIFYLLAGVFAYAVGQSLGNITVLATLVLIAGMCVNGA 369 G + AVG G D+ N +V+ +F+ +A V +G + + VL L+ IAG G+ Sbjct: 299 GAIFGAVGGGVLGDKLNLPRVLAVFFAMAAVSITLLGFN-SPMPVLYLLIAIAGATTIGS 357 Query: 370 QSAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWSGATLLGLGWNFEQVLTALLVPA 429 Q + + AA+FY R+TG+ W GIGR GAI+G G LLG+ + A +P Sbjct: 358 QILLYACAAQFYSMTIRSTGLGWASGIGRNGAIVGPLLGGALLGISLPLQLNFMAFALPG 417 Query: 430 ALATVGVIVKGLVSHADA 447 A+AT+ + V + S A Sbjct: 418 AVATLAMTVFAISSRRSA 435 Lambda K H 0.325 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 589 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 448 Length of database: 447 Length adjustment: 33 Effective length of query: 415 Effective length of database: 414 Effective search space: 171810 Effective search space used: 171810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory