Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate PfGW456L13_2961 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2961 Length = 317 Score = 132 bits (331), Expect = 1e-35 Identities = 102/298 (34%), Positives = 150/298 (50%), Gaps = 35/298 (11%) Query: 37 DTAVLAQ---GFEVVCAF-----VNDDLSR--PVLERLAAGGTRLVALRSAGYNHVDLAA 86 DT+ LA+ GFEV+C ++DL R P L+ L GG R AL DL Sbjct: 39 DTSSLAERLAGFEVICVMRERTRFDEDLLRRLPKLKLLVTGGMRNAAL--------DLKT 90 Query: 87 AEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTREGDFSLHGLTGFDLHGKR 146 A ALG+ V +Y HA E LI+ R L N R G + GL G DLHGK Sbjct: 91 AAALGIQVSGTDSYK-HAAPELTWALIMAATRNLVVEANALRAGQWQ-QGLGG-DLHGKT 147 Query: 147 VGVIGTGQIGETFARIMAGFGCELLAY-DPYPNPRIQALGGRYLALDALLAESDIVSLHC 205 + ++G G IG+ A+ FG ++A+ + R +G ++ L ++D++S+H Sbjct: 148 LAILGLGSIGQRVAQFGQVFGMRVIAWSENLTAERAAQVGVTRVSKQELFEQADVLSVHL 207 Query: 206 PLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAALIEALKSGQLGYLGLDVYEEEAD 265 L+ +R L+DAQ L MKP A+L+NT RG +V+ AALI+AL+ +L LDV+E+E Sbjct: 208 VLSERSRGLVDAQALGWMKPSALLVNTARGPIVDEAALIKALQKQRLAGAALDVFEQE-- 265 Query: 266 IFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREALAAIADTTLDNIAAWQDGTP 323 PL R L NV+ T H +++++ +++I AW G P Sbjct: 266 ---------PLPAHHPFRTLD--NVLATPHVGYVSQQNYRLFFLQMIEDIQAWSAGAP 312 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 317 Length adjustment: 28 Effective length of query: 301 Effective length of database: 289 Effective search space: 86989 Effective search space used: 86989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory