Align Glycerol uptake facilitator protein 4; D/L-lactic acid transporter; Lactic acid channel (characterized)
to candidate PfGW456L13_1735 Glycerol uptake facilitator protein
Query= SwissProt::F9UMX3 (238 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1735 Length = 297 Score = 96.7 bits (239), Expect = 5e-25 Identities = 78/250 (31%), Positives = 122/250 (48%), Gaps = 26/250 (10%) Query: 4 QLLAEFMGTALMIIFGVGVHCSEVLKGTKYRGSGHIFAITTWGFGITIALFIFGNVC--- 60 Q +AEF+GTAL+I FG G + + G + G I I WG G+++A+++ V Sbjct: 27 QCMAEFLGTALLIFFGTGCVAALKVAGASF-GLWEISII--WGVGVSMAIYLTAGVSGAH 83 Query: 61 INPAMVLAQCILGNLSWSLFIPYSVAEVLGGVVGAVIVWIMYAD--------HFAASADE 112 +NPA+ +A I + Y A+V G GA++V+ +Y++ H + Sbjct: 84 LNPAVSIALSIFADFEKRKLPFYIFAQVAGAFCGALLVYTLYSNLFFEFEQTHHMVRGTQ 143 Query: 113 ISPITIRNLFSTAP-AVRNLPRNFFVEFFDTFIFISGILAISE-----VKTPGIVPIGVG 166 S + + ++FST P V + F VE T I + I+++++ K P + P+ +G Sbjct: 144 AS-LELASVFSTFPNPVLTTAQAFLVEVIITAILMGVIMSLTDDNNGLPKGP-LAPLLIG 201 Query: 167 LLVWAIGMGLGGPTGFAMNLARDMGPRIAHAIL---PIKNKADSDWQYGIIVPGIAPFVG 223 LL+ IG +G TGFAMN ARD GP++ I D Y ++P AP VG Sbjct: 202 LLIAVIGSSMGPLTGFAMNPARDFGPKLMTFFAGWGEISFTGGRDIPY-FLIPVFAPIVG 260 Query: 224 AACAALFMHG 233 A A G Sbjct: 261 ACLGAAAYRG 270 Lambda K H 0.330 0.146 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 297 Length adjustment: 25 Effective length of query: 213 Effective length of database: 272 Effective search space: 57936 Effective search space used: 57936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory