GapMind for catabolism of small carbon sources

 

Aligments for a candidate for araG in Pseudomonas fluorescens GW456-L13

Align L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized)
to candidate PfGW456L13_7 ABC transporter ATP-binding protein

Query= CharProtDB::CH_014279
         (504 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_7 ABC transporter
           ATP-binding protein
          Length = 521

 Score =  238 bits (607), Expect = 4e-67
 Identities = 160/496 (32%), Positives = 254/496 (51%), Gaps = 21/496 (4%)

Query: 6   PYLSFRGIGKTFPGVKALTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPTTGSVV 65
           P L  R I K +PG  A   I      G++HAL+GENGAGKSTL+KI+ G     +G V+
Sbjct: 12  PRLQLRRITKRYPGCLANDAIDLTIAPGEIHALLGENGAGKSTLMKIIYGVTHADSGEVI 71

Query: 66  INGQEMSFSDTTAALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLLNYEAG 125
             GQ +S  +   A   G+ +++Q   L   ++VA+NI L      G       L  +  
Sbjct: 72  WQGQRVSLRNPAQARGLGIGMVFQHFSLFETLSVAQNIALAMGAAAG---TPKQLEPKIR 128

Query: 126 LQLKHLGMDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIDNLFRV 185
              +  GM ++P+  +  LSIG+ Q VEI + L ++ +++  DEPTS L+ +E D+LF  
Sbjct: 129 EVSRRYGMTLEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQEADDLFVT 188

Query: 186 IRELRKEGRVILYVSHRMEEIFALSDAITVFKDGRYVKTFTDMQQVDHDALVQAMVGRDI 245
           +R L  EG  IL++SH++ E+ AL  + TV + GR        +  D   L + MVG + 
Sbjct: 189 LRRLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAECSDQQ-LARLMVG-EA 246

Query: 246 GDIYGWQPRSYGEERLRLDAVKAPGVRTP---------ISLAVRSGEIVGLFGLVGAGRS 296
            ++    P+  G +   LD V+      P         I L VR GEIVG+ G+ G G+ 
Sbjct: 247 AELIADYPKVTGGDAC-LD-VRGLSWHNPDPFGCSLANIDLEVRRGEIVGIAGVAGNGQD 304

Query: 297 ELMKGMFGGTQI---TAGQVYIDQQPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVHSVRD 353
           EL+  + G   +    +  +   ++P+   +P      G+   P +R   G +P  S+ D
Sbjct: 305 ELLALLSGEALLPRNASATIRFGKEPVAHLRPDARRQLGLAFVPAERLGHGAVPELSLAD 364

Query: 354 NINISARRKHVLGGCVINNGWEENNADHHIRSLNIKTPGAEQLIMNLSGGNQQKAILGRW 413
           N  ++A +  ++   +I  G  E  A+  IR   +KTP ++    +LSGGN QK ILGR 
Sbjct: 365 NALLTAFQHGLVSNGLIQRGKVEALAEEIIRRFGVKTPDSQAPARSLSGGNLQKFILGRE 424

Query: 414 LSEEMKVILLDEPTRGIDVGAKHEIYNVIYALAAQGVAVLFASSDLPEVLGVADRIVVMR 473
           + ++ ++++   PT G+DVGA   I+  + AL   G A+L  S DL E+  ++DR+  + 
Sbjct: 425 ILQQPRLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISEDLDELFQISDRLGALC 484

Query: 474 EGEIAGELLHEQADER 489
            G ++   LH   D R
Sbjct: 485 GGRLSA--LHATVDTR 498



 Score = 87.0 bits (214), Expect = 1e-21
 Identities = 65/251 (25%), Positives = 123/251 (49%), Gaps = 20/251 (7%)

Query: 260 RLRLDAVKAPG--VRTPISLAVRSGEIVGLFGLVGAGRSELMKGMFGGTQITAGQVYIDQ 317
           +LR    + PG      I L +  GEI  L G  GAG+S LMK ++G T   +G+V    
Sbjct: 15  QLRRITKRYPGCLANDAIDLTIAPGEIHALLGENGAGKSTLMKIIYGVTHADSGEVIWQG 74

Query: 318 QPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVH-SVRDNINISARRKHVLGGCVINNGWEE 376
           Q + +R P+ A   G+          G++  H S+ + ++++      +G          
Sbjct: 75  QRVSLRNPAQARGLGI----------GMVFQHFSLFETLSVAQNIALAMGAAA----GTP 120

Query: 377 NNADHHIRSLNIK---TPGAEQLIMNLSGGNQQKAILGRWLSEEMKVILLDEPTRGIDVG 433
              +  IR ++ +   T   E+L+ +LS G +Q+  + R L +++++++LDEPT  +   
Sbjct: 121 KQLEPKIREVSRRYGMTLEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQ 180

Query: 434 AKHEIYNVIYALAAQGVAVLFASSDLPEVLGVADRIVVMREGEIAGELLHEQADERQALS 493
              +++  +  LAA+G ++LF S  L EV  +     V+R G +AG  +  +  ++Q   
Sbjct: 181 EADDLFVTLRRLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAECSDQQLAR 240

Query: 494 LAMPKVSQAVA 504
           L + + ++ +A
Sbjct: 241 LMVGEAAELIA 251


Lambda     K      H
   0.319    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 614
Number of extensions: 28
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 504
Length of database: 521
Length adjustment: 35
Effective length of query: 469
Effective length of database: 486
Effective search space:   227934
Effective search space used:   227934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory