Align agmatine deiminase (EC 3.5.3.12) (characterized)
to candidate PfGW456L13_3370 Agmatine deiminase (EC 3.5.3.12)
Query= BRENDA::Q9I6J9 (368 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 Length = 374 Score = 382 bits (980), Expect = e-110 Identities = 183/361 (50%), Positives = 244/361 (67%), Gaps = 4/361 (1%) Query: 6 STPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQAAFAAVAKAIARFEPVTVCAS 65 +TP+ DGFR+P E+E W+ WPER D WRNG KPAQ + + AI+ EPVTVCAS Sbjct: 7 TTPKQDGFRLPGEFEAKSGCWLGWPERTDVWRNGAKPAQKVWVQIVTAISMSEPVTVCAS 66 Query: 66 AGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVIDD-KGDVRGVDWGFNAWGGFEGG 124 A Q+ AR +L +RVVE++ +D W RD+GP FV++D +G+VRGVD+ FNA+GG +GG Sbjct: 67 AAQFATARRQLPP-QVRVVEMTCNDTWFRDSGPCFVVNDQRGEVRGVDFEFNAYGGLDGG 125 Query: 125 LYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVDGEGTLITTEECLLNHNRNPHL 184 LY+PW +DDQ+A KILEIER RYR + E G I DG+G+++TTE+CLLN NRN HL Sbjct: 126 LYYPWDKDDQIAGKILEIERFDRYRAP-LIAELGGIQSDGQGSILTTEQCLLNRNRNQHL 184 Query: 185 SQAEIERTLRDYLAVESIIWLPNGLYNDETDGHVDNFCCYARPGEVLLAWTDDQDDPNYL 244 + E+ R L DYL E +IWLP G DETDGHVD+ C+ RPGEV+L WTD++DDP + Sbjct: 185 GKDEVTRRLTDYLGAEQVIWLPRGCKFDETDGHVDDLACFVRPGEVVLQWTDNRDDPQWE 244 Query: 245 RCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRLAGSY 304 Q A +L +RD++GR+L+VHK+P P L T EE +G+D + + R ++ SY Sbjct: 245 IYQEAYDILRSTRDSRGRELIVHKLPQPDVLEWTAEEAEGLDRQDSTHTRQAGTKICASY 304 Query: 305 VNFLIVNGGIIAPSFDDPKDAEARAILQRVFPEHEVVMVP-GREILLGGGNIHCITQQQP 363 +N+ N I+ P F D D A A L +FP+H +V + REILLGGGN+ CIT Q Sbjct: 305 INYYAGNSSIVVPLFGDRNDKVALATLAELFPQHSIVGIENSREILLGGGNVACITMPQY 364 Query: 364 A 364 A Sbjct: 365 A 365 Lambda K H 0.319 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 374 Length adjustment: 30 Effective length of query: 338 Effective length of database: 344 Effective search space: 116272 Effective search space used: 116272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_3370 (Agmatine deiminase (EC 3.5.3.12))
to HMM TIGR03380 (aguA: agmatine deiminase (EC 3.5.3.12))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03380.hmm # target sequence database: /tmp/gapView.20304.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03380 [M=357] Accession: TIGR03380 Description: agmatine_aguA: agmatine deiminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-167 542.6 0.0 2.2e-167 542.4 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 Agmatine deiminase (EC 3.5.3.12) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 Agmatine deiminase (EC 3.5.3.12) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.4 0.0 2.2e-167 2.2e-167 1 356 [. 7 364 .. 7 365 .. 0.99 Alignments for each domain: == domain 1 score: 542.4 bits; conditional E-value: 2.2e-167 TIGR03380 1 ttpkedgfrlPaefekqkevwliWPerpDnWregakpaqkafaevakaiakvepv 55 ttpk+dgfrlP+efe+++ +wl WPer+D Wr+gakpaqk+++++++ai+ +epv lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 7 TTPKQDGFRLPGEFEAKSGCWLGWPERTDVWRNGAKPAQKVWVQIVTAISMSEPV 61 69***************************************************** PP TIGR03380 56 tvlvskeqyenarkalpeeirvvemssnDawirDvGPtfvvndk.gelrgvdwef 109 tv++s++q++ ar++lp ++rvvem++nD+w+rD+GP fvvnd+ ge+rgvd+ef lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 62 TVCASAAQFATARRQLPPQVRVVEMTCNDTWFRDSGPCFVVNDQrGEVRGVDFEF 116 ******************************************9769********* PP TIGR03380 110 nawgglkdGlyfpWdkDdkvarkvleleridryradlvleggsihvDGeGtlltt 164 na+ggl++Gly pWdkDd++a k+le+er dryra+l+ e g+i++DG+G +ltt lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 117 NAYGGLDGGLYYPWDKDDQIAGKILEIERFDRYRAPLIAELGGIQSDGQGSILTT 171 ******************************************************* PP TIGR03380 165 eeclLsegrnpelskeeieeklkeylgvekviWlkeGlyldetnGhvDnllnfvr 219 e+clL+++rn++l k+e++++l +ylg+e+viWl++G++ det+GhvD+l++fvr lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 172 EQCLLNRNRNQHLGKDEVTRRLTDYLGAEQVIWLPRGCKFDETDGHVDDLACFVR 226 ******************************************************* PP TIGR03380 220 PGevvlswtddesdPqyeiskealevLenetDakGrklkvhklklpeplllteee 274 PGevvl+wtd+++dPq+ei +ea+++L++++D++Gr+l vhkl++p+ l++t+ee lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 227 PGEVVLQWTDNRDDPQWEIYQEAYDILRSTRDSRGRELIVHKLPQPDVLEWTAEE 281 ******************************************************* PP TIGR03380 275 akgvdavegtlpreagerlaasyvnyliankaiilPlfddekDkeakkllqelfP 329 a+g+d+ ++t++r+ag++++asy+ny++ n++i++Plf+d++Dk+a ++l+elfP lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 282 AEGLDRQDSTHTRQAGTKICASYINYYAGNSSIVVPLFGDRNDKVALATLAELFP 336 ******************************************************* PP TIGR03380 330 drkvvgv.kareillgGGnihcitqqip 356 ++++vg+ ++reillgGGn++cit+ ++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3370 337 QHSIVGIeNSREILLGGGNVACITMPQY 364 *******899**************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (357 nodes) Target sequences: 1 (374 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.58 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory