Align N-carbamoylputrescine amidohydrolase (EC 3.5.1.53) (characterized)
to candidate PfGW456L13_2675 5-aminopentanamidase (EC 3.5.1.30)
Query= metacyc::MONOMER-17350 (290 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2675 Length = 279 Score = 87.4 bits (215), Expect = 3e-22 Identities = 72/231 (31%), Positives = 120/231 (51%), Gaps = 17/231 (7%) Query: 25 IEEASKQGAELICLGELHQSEYFCQSENVDFFDYANDYE-KDVKFWANIARKNQIVLITS 83 I +A+ QGA+++ L EL QS Y ++ + A + ++ W +AR+ +V++ Sbjct: 32 IRQAAFQGAQVVVLPELVQSGYLF-ADRFEALGLAETVDGPTLQLWQTLARELNLVIVGG 90 Query: 84 LFEKRSAGLYHNTAVVFEKDGSIAGKYRKMHIPDDPCFYEKFYFTPGDLGFEPINTSLGK 143 E+ A N+A + + +G + YRK H+ D EK FT GD + T G+ Sbjct: 91 FCERLPADELANSAAMIDANG-LRAVYRKAHLWDA----EKDIFTAGDAPPPVVETLHGR 145 Query: 144 LGVLICWDQWYPEAARIMALKGAEILIYPTAIGWFDKDKDE-EKQRQLNAWLGVQKGHAI 202 LG+LIC+D +PE R+ AL GAE+L P + W D + + E+ ++ L VQ +A Sbjct: 146 LGMLICYDLEFPEWVRLAALAGAELLCAP--VNWPDGPRPQTERPAEV---LRVQ-ANAS 199 Query: 203 ANGLYVVAINRVGFEKDVSGVEEGIRFWGNSF-VFGP--QGEELCLLDSQN 250 N +++ A +R G E+ V V+ + + + + GP QG E LL + N Sbjct: 200 VNRMFIAACDRYGHERGVGWVQGSVIVDADGYPLAGPAEQGGEQMLLATLN 250 Lambda K H 0.322 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 279 Length adjustment: 26 Effective length of query: 264 Effective length of database: 253 Effective search space: 66792 Effective search space used: 66792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory