GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcB in Pseudomonas fluorescens GW456-L13

Align Ornithine carbamoyltransferase 1, anabolic; OTCase 1; Ornithine carbamoyltransferase 1, phaseolotoxin-sensitive; SOCT; EC 2.1.3.3 (characterized)
to candidate PfGW456L13_1739 Ornithine carbamoyltransferase (EC 2.1.3.3)

Query= SwissProt::Q02047
         (306 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739 Ornithine
           carbamoyltransferase (EC 2.1.3.3)
          Length = 307

 Score =  537 bits (1384), Expect = e-157
 Identities = 268/306 (87%), Positives = 284/306 (92%)

Query: 1   MNARHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFEPLKNRVLGMIFEKSSTRTRLSF 60
           M+ARHFLS+MD TP+EL+ +IRRGVELKDLR RG LFEPLKNRVLGMIFEKSSTRTR+SF
Sbjct: 2   MSARHFLSLMDCTPEELVSVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRISF 61

Query: 61  EAGMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRV 120
           EAGMIQLGGQAIFLS RDTQLGRGEPI D A VMS MLDAVMIRT+AHSNLTEFAANSRV
Sbjct: 62  EAGMIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSSMLDAVMIRTFAHSNLTEFAANSRV 121

Query: 121 PVINGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV 180
           PVINGLSDDLHPCQLLADMQTFLEHRGSI+GKTVAWIGDGNNMCNSYIEAAIQFDFQLRV
Sbjct: 122 PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV 181

Query: 181 ACPAGYEPNPEFLALAGERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPF 240
           ACP GYEPNP FLA AG+RVTIVRDPK AV GAHLVSTDVWTSMGQEEETA+R+ LFAP+
Sbjct: 182 ACPEGYEPNPVFLAKAGDRVTIVRDPKEAVRGAHLVSTDVWTSMGQEEETAKRLQLFAPY 241

Query: 241 QVTRASLDLAEKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFLVA 300
           QV RA LDLA +DVLFMHCLPAHRGEEIS+DLLDD RSVAWDQAENRLHAQKALLEFLV 
Sbjct: 242 QVNRALLDLAAEDVLFMHCLPAHRGEEISIDLLDDKRSVAWDQAENRLHAQKALLEFLVE 301

Query: 301 PSHQRA 306
           P++  A
Sbjct: 302 PAYHHA 307


Lambda     K      H
   0.322    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 377
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 306
Length of database: 307
Length adjustment: 27
Effective length of query: 279
Effective length of database: 280
Effective search space:    78120
Effective search space used:    78120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate PfGW456L13_1739 (Ornithine carbamoyltransferase (EC 2.1.3.3))
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00658.hmm
# target sequence database:        /tmp/gapView.6912.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00658  [M=304]
Accession:   TIGR00658
Description: orni_carb_tr: ornithine carbamoyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
   2.4e-117  377.4   0.0   2.7e-117  377.3   0.0    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739  Ornithine carbamoyltransferase (


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739  Ornithine carbamoyltransferase (EC 2.1.3.3)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  377.3   0.0  2.7e-117  2.7e-117       1     303 [.       5     300 ..       5     301 .. 0.99

  Alignments for each domain:
  == domain 1  score: 377.3 bits;  conditional E-value: 2.7e-117
                                               TIGR00658   1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRv 55 
                                                             rh+lsl+d ++eel++++ ++ +lk  +++g+  + lk++ l++iFek+stRtR+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739   5 RHFLSLMDCTPEELVSVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRI 59 
                                                             8****************************************************** PP

                                               TIGR00658  56 sfevaayelGaqvlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedvee 110
                                                             sfe+++++lG+q+++l++ ++qlgr+e+i D a v+s+++da+++R+++h++++e
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739  60 SFEAGMIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSSMLDAVMIRTFAHSNLTE 114
                                                             ******************************************************* PP

                                               TIGR00658 111 lakyasvPvingLtdlehPcqilaDlltikeklgklkevklvyvGDannvansll 165
                                                             +a ++ vPvingL+d  hPcq+laD++t  e+ g++++ +++++GD+nn++ns +
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739 115 FAANSRVPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYI 169
                                                             ******************************************************* PP

                                               TIGR00658 166 laaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadvi 220
                                                              aa ++ ++++va+Peg+ep++  + ka       g ++++++dpk+av++a+++
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739 170 EAAIQFDFQLRVACPEGYEPNPVFLAKA-------GDRVTIVRDPKEAVRGAHLV 217
                                                             **********************998887.......88****************** PP

                                               TIGR00658 221 ytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtde 275
                                                              tDvw+smG+ee++++rl+l+ pyqvn+ ll+la ++v f+hCLPa+rGee++ +
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739 218 STDVWTSMGQEEETAKRLQLFAPYQVNRALLDLAAEDVLFMHCLPAHRGEEISID 272
                                                             ******************************************************* PP

                                               TIGR00658 276 vlegeasivfdeaenRlhaqkavlkall 303
                                                              l+ ++s+ +d+aenRlhaqka+l++l+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739 273 LLDDKRSVAWDQAENRLHAQKALLEFLV 300
                                                             ************************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (307 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.82
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory