GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcC in Pseudomonas fluorescens GW456-L13

Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate PfGW456L13_1872 Carbamate kinase (EC 2.7.2.2)

Query= uniprot:P13982
         (310 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872 Carbamate
           kinase (EC 2.7.2.2)
          Length = 309

 Score =  511 bits (1317), Expect = e-150
 Identities = 253/310 (81%), Positives = 283/310 (91%), Gaps = 1/310 (0%)

Query: 1   MRIVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVAPGNELVIAHGNGPQVGLLALQ 60
           MRIVVALGGNALLRRGEPMTADNQR N+RIA EQIAK+ PGN+LVIAHGNGPQVGLL+LQ
Sbjct: 1   MRIVVALGGNALLRRGEPMTADNQRANIRIATEQIAKIHPGNQLVIAHGNGPQVGLLSLQ 60

Query: 61  GAAYDKVSPYPLDVLGAETEGMIGYMIEQEMGNLLPFEVPFATILTQVEVDGKDPAFQNP 120
            AAY  VSPYPLDVLGAETEGMIGY+IEQE+GNLL FEVPFAT+LTQVEVD  DPAF+NP
Sbjct: 61  AAAYTSVSPYPLDVLGAETEGMIGYIIEQELGNLLDFEVPFATLLTQVEVDANDPAFKNP 120

Query: 121 TKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIVI 180
           TKPIGPVY++EEAE LAAEKGW+IAPDGDK+RRVV SP+PKRIFEIRP+KWLLEK +IVI
Sbjct: 121 TKPIGPVYTKEEAEALAAEKGWAIAPDGDKYRRVVASPKPKRIFEIRPIKWLLEKSSIVI 180

Query: 181 CAGGGGIPTMYDEAGKKLSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGKPT 240
           CAGGGGIPTMY   G KL GVEAVIDKDLCS+LLA++L AD+L+IATDV+AA++D+GKPT
Sbjct: 181 CAGGGGIPTMYTSPG-KLEGVEAVIDKDLCSALLAEQLEADLLVIATDVNAAFIDFGKPT 239

Query: 241 QKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGTRV 300
           QKAIAQAHPDE+E+LGFAAGSMGPKVQAA EFAR TGK AVIGSL+DI AI +GKAGTR+
Sbjct: 240 QKAIAQAHPDEMEKLGFAAGSMGPKVQAACEFARHTGKVAVIGSLSDIEAIVQGKAGTRI 299

Query: 301 STRKAGIEYR 310
           ST   GI Y+
Sbjct: 300 STATPGISYQ 309


Lambda     K      H
   0.317    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 399
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 310
Length of database: 309
Length adjustment: 27
Effective length of query: 283
Effective length of database: 282
Effective search space:    79806
Effective search space used:    79806
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)

Align candidate PfGW456L13_1872 (Carbamate kinase (EC 2.7.2.2))
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00746.hmm
# target sequence database:        /tmp/gapView.14316.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00746  [M=309]
Accession:   TIGR00746
Description: arcC: carbamate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
   1.4e-133  430.6   0.2   1.6e-133  430.5   0.2    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872  Carbamate kinase (EC 2.7.2.2)


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872  Carbamate kinase (EC 2.7.2.2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  430.5   0.2  1.6e-133  1.6e-133       1     308 [.       1     300 [.       1     301 [. 0.98

  Alignments for each domain:
  == domain 1  score: 430.5 bits;  conditional E-value: 1.6e-133
                                               TIGR00746   1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqv 55 
                                                             +++vvaLGGnall+rge ++a++qr n+++a++q++k++  g++lvi+hGngPqv
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872   1 MRIVVALGGNALLRRGEPMTADNQRANIRIATEQIAKIHP-GNQLVIAHGNGPQV 54 
                                                             589*************************************.************** PP

                                               TIGR00746  56 GalllqneaadsvpakPldvlgaesqgliGYllqqalkeelakeglekkvatvlt 110
                                                             G l lq +a+ sv+++Pldvlgae++g+iGY+++q+l + l    +e ++at+lt
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872  55 GLLSLQAAAYTSVSPYPLDVLGAETEGMIGYIIEQELGNLLD---FEVPFATLLT 106
                                                             *****************************************9...********** PP

                                               TIGR00746 111 qvivdekDeaFqnPtkpigpfydeeeakrlaaekgailkedagrgwRrvvpsPkP 165
                                                             qv+vd++D+aF+nPtkpigp+y++eea++laaekg+ ++  +g+++Rrvv+sPkP
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872 107 QVEVDANDPAFKNPTKPIGPVYTKEEAEALAAEKGWAIAP-DGDKYRRVVASPKP 160
                                                             ****************************************.99************ PP

                                               TIGR00746 166 keiveaeviktLvekgvivissgGGGvPvvkdg.kelkGveaviDkDlasekLae 219
                                                             k+i+e++ ik+L+ek  ivi++gGGG+P+++    +l+GveaviDkDl+s++Lae
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872 161 KRIFEIRPIKWLLEKSSIVICAGGGGIPTMYTSpGKLEGVEAVIDKDLCSALLAE 215
                                                             *****************************9876256******************* PP

                                               TIGR00746 220 evnaDilviltdvdavyvnygkpdekkleevkveeleelakdgefaaGsmgPkve 274
                                                             +++aD lvi+tdv+a+++++gkp++k++++++++e+e+l     faaGsmgPkv+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872 216 QLEADLLVIATDVNAAFIDFGKPTQKAIAQAHPDEMEKLG----FAAGSMGPKVQ 266
                                                             ****************************************....*********** PP

                                               TIGR00746 275 aaiefvesrgkkaiitslekivealegkaGtvvv 308
                                                             aa ef++ +gk a+i+sl++i+++++gkaGt+++
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1872 267 AACEFARHTGKVAVIGSLSDIEAIVQGKAGTRIS 300
                                                             ********************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (309 nodes)
Target sequences:                          1  (309 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 11.05
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory