Align AotJ aka PA0888, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate PfGW456L13_1692 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein
Query= TCDB::O50181 (259 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1692 Length = 258 Score = 311 bits (796), Expect = 1e-89 Identities = 155/258 (60%), Positives = 195/258 (75%), Gaps = 2/258 (0%) Query: 1 MKKLALLGALALSVLSLPT-FAADKPVRIGIEAAYPPFSLKTPDGQLAGFDVDIGNALCE 59 MKK L+ LALS+L+ + FAA+K +RIGIEAAYPPF+ KT G++ GFD DIGNALC Sbjct: 1 MKKFPLITGLALSLLACSSVFAAEKTLRIGIEAAYPPFASKTDKGEIVGFDYDIGNALCA 60 Query: 60 EMKVQCKWVEQEFDGLIPALKVRKIDAILSSMTITDERKRSVDFTNKYYNTPARFVMKEG 119 +MK +C WVE EFDGLIP+LKV+KID LSSMTI ++RK+SVDFT+KYY T +R VMK+G Sbjct: 61 QMKAKCVWVEGEFDGLIPSLKVKKIDMALSSMTINEDRKKSVDFTHKYYFTSSRLVMKDG 120 Query: 120 ASLNDPKADLKGKKAGVLRGSTADRYASAELTPAGVEVVRYNSQQEANMDLVAGRLDAVV 179 A ++D A LKGK GV R +T DRYAS P G+ V RY++ +E MDL AGRLDA+ Sbjct: 121 AVVDDQYASLKGKTVGVQRATTTDRYASEVFEPKGINVKRYSNNEEIYMDLAAGRLDAIF 180 Query: 180 ADSVNLEDGFLKTDAGKGYAFVGPQLTDAKYFGEGVGIAVRKGDSELAGKFNAAIDALRA 239 AD++ L D FL GKGYAFVGP+L D KY GEG GIAVRKG++EL + N AID +RA Sbjct: 181 ADTIPLND-FLSMPRGKGYAFVGPELKDPKYVGEGAGIAVRKGNTELVSELNTAIDGIRA 239 Query: 240 NGKYKQIQDKYFSFDVYG 257 +G+Y++I +KYF D+YG Sbjct: 240 SGEYQKISEKYFKSDIYG 257 Lambda K H 0.316 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory