GapMind for catabolism of small carbon sources

 

Aligments for a candidate for artJ in Pseudomonas fluorescens GW456-L13

Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate PfGW456L13_377 Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)

Query= TCDB::Q9HU31
         (250 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_377
           Lysine-arginine-ornithine-binding periplasmic protein
           precursor (TC 3.A.1.3.1)
          Length = 249

 Score =  402 bits (1033), Expect = e-117
 Identities = 194/250 (77%), Positives = 222/250 (88%), Gaps = 1/250 (0%)

Query: 1   MKNYKKILLAAAATLAFALDASAADKLRIGTEGAYPPFNGIDASGQAVGFDLDIGKALCA 60
           M+NYKK+ LAAA TLAF+  A A + L++G E AYPPFN  DASG  VGFD +IG ALCA
Sbjct: 1   MQNYKKVFLAAAVTLAFSAGAMA-ETLKMGIEAAYPPFNNKDASGNVVGFDKEIGDALCA 59

Query: 61  KMKTECEVVTSDWDGIIPALNAKKFDFIVASMSITDERKQAVDFTDPYYTNKLQFVAPKS 120
           KMK EC VVTSDWDGIIPALNAKKFDF+++SMSITDERKQAVDFTDPYY+NKLQF+A K 
Sbjct: 60  KMKVECTVVTSDWDGIIPALNAKKFDFLISSMSITDERKQAVDFTDPYYSNKLQFIAKKD 119

Query: 121 VDFKTDKDSLKGKVIGAQRATIAGTWLEDNMADVVTIKLYDTQENAYLDLSSGRLDGVLA 180
           +DFKTDK +LKGK+IGAQRAT+AGT+LEDN  D +TIKLYDTQENAYLDL+SGRLDG+LA
Sbjct: 120 IDFKTDKAALKGKIIGAQRATLAGTFLEDNYGDDITIKLYDTQENAYLDLTSGRLDGILA 179

Query: 181 DKFVQYDWLKSDAGKEFEFKGEPVFDNDKIGIAVRKGDPLREKLNAALKEIVADGTYKKI 240
           DK+V Y+WLKSDAG+ +EFKG+PV ++DKIGIAVRK DP+REKLN ALKEIVADGTYKKI
Sbjct: 180 DKYVNYEWLKSDAGRSYEFKGDPVEESDKIGIAVRKKDPIREKLNTALKEIVADGTYKKI 239

Query: 241 NDKYFPFSIY 250
           NDKYFPFSIY
Sbjct: 240 NDKYFPFSIY 249


Lambda     K      H
   0.317    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 329
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 250
Length of database: 249
Length adjustment: 24
Effective length of query: 226
Effective length of database: 225
Effective search space:    50850
Effective search space used:    50850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory