Align Arginine N-succinyltransferase; AST; AOST; EC 2.3.1.109 (characterized)
to candidate PfGW456L13_1973 Arginine N-succinyltransferase (EC 2.3.1.109)
Query= SwissProt::P0AE37 (344 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 Length = 341 Score = 345 bits (884), Expect = 1e-99 Identities = 175/342 (51%), Positives = 235/342 (68%), Gaps = 2/342 (0%) Query: 2 MVIRPVERSDVSALMQLASKTGGGLTSLPANEATLSARIERAIKTWQGELPKSEQGYVFV 61 M++RPV SD+ AL+ LA TG GLT+LPANE L+ R+ A KT++GE + + Y+FV Sbjct: 1 MIVRPVRSSDLPALIDLARSTGTGLTTLPANEERLAHRVGWAEKTFRGEAGRGDADYLFV 60 Query: 62 LEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSE 121 LED + G V GI AI AVGL +PWYN+RVG V AS+ELN+Y +PTLFL+ND TG+SE Sbjct: 61 LEDDD-GRVVGISAIAGAVGLREPWYNFRVGLTVSASQELNIYREIPTLFLANDLTGNSE 119 Query: 122 LCTLFLDPDWRKEGNGYLLSKSRFMFMAAFRDKFNDKVVAEMRGVIDEHGYSPFWQSLGK 181 LC+LFL D+R NG +LSK+R +F+A F F +K++AEMRGV DE G SPFW+SLG+ Sbjct: 120 LCSLFLHADYRSGLNGRMLSKARMLFIAEFPQLFGNKIIAEMRGVSDEAGRSPFWESLGR 179 Query: 182 RFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSQEAQDVIGQVHPQTAPARAVLEK 241 FF M+FS+AD+L G G KAFIAELMPK P+YT FLS +A++VIGQVHP T PA A+L+ Sbjct: 180 HFFKMEFSQADYLTGVGNKAFIAELMPKFPLYTCFLSPDARNVIGQVHPDTEPALAMLKS 239 Query: 242 EGFRYRNYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAQGDFPACLVANENYHHFR 301 EGF Y+ Y+DIFD GP +EC+ ++RA+R S+ + +A G P D ++ N R Sbjct: 240 EGFSYQGYVDIFDAGPAIECETGKIRAVRDSQALVLAVGTPGD-DATPFIIHNRKREDCR 298 Query: 302 VVLVRTDPATERLILTAAQLDALKCHAGDRVRLVRLCAEEKT 343 + A L++ L+ +AGD+VR V L A ++ Sbjct: 299 ITAAPARLAAGTLVVDPLTAKRLQLNAGDQVRAVALSAARES 340 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 341 Length adjustment: 29 Effective length of query: 315 Effective length of database: 312 Effective search space: 98280 Effective search space used: 98280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_1973 (Arginine N-succinyltransferase (EC 2.3.1.109))
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.12387.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-162 523.6 0.0 9.8e-162 523.4 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 Arginine N-succinyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 Arginine N-succinyltransferase (EC 2.3.1.109) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 523.4 0.0 9.8e-162 9.8e-162 1 336 [] 2 334 .. 2 334 .. 0.99 Alignments for each domain: == domain 1 score: 523.4 bits; conditional E-value: 9.8e-162 TIGR03244 1 ivrpvktsdldallelakeaGvGltslpaneellekrieraeksfageleraeeg 55 ivrpv++sdl+al++la+++G+Glt+lpanee+l++r+ +aek+f+ge+ r++++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 2 IVRPVRSSDLPALIDLARSTGTGLTTLPANEERLAHRVGWAEKTFRGEAGRGDAD 56 79***************************************************** PP TIGR03244 56 ylfvledtetgkvvGvsaieaavGleepfynyrvgkvvhaskelniykkletlfl 110 ylfvled ++g+vvG+sai+ avGl+ep+yn+rvg +v+as+elniy++++tlfl lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 57 YLFVLED-DDGRVVGISAIAGAVGLREPWYNFRVGLTVSASQELNIYREIPTLFL 110 *******.99********************************************* PP TIGR03244 111 sndltgaselCtlfldeeyrkelnGkllskarflflaefkerfskkiiaemrGvs 165 +ndltg+selC+lfl+ +yr++lnG++lskar+lf+aef+++f++kiiaemrGvs lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 111 ANDLTGNSELCSLFLHADYRSGLNGRMLSKARMLFIAEFPQLFGNKIIAEMRGVS 165 ******************************************************* PP TIGR03244 166 deeGrsPfWealgkkffsldfskadylsgiGkkafiaelmPkfPiyvdllskeaq 220 de GrsPfWe+lg++ff+++fs+adyl+g+G+kafiaelmPkfP+y+++ls +a+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 166 DEAGRSPFWESLGRHFFKMEFSQADYLTGVGNKAFIAELMPKFPLYTCFLSPDAR 220 ******************************************************* PP TIGR03244 221 dvigkvhektkPalalleseGlryqgyvdifdaGptleaevakiravresklvev 275 +vig+vh++t+Pala+l+seG+ yqgyvdifdaGp++e+e+ kiravr+s+ +++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 221 NVIGQVHPDTEPALAMLKSEGFSYQGYVDIFDAGPAIECETGKIRAVRDSQALVL 275 ******************************************************* PP TIGR03244 276 avaesaaedeaepylvanekledfrvvlvessldaeelvlsaeeakalkveeGdk 330 av+++ +++ +p++++n+k ed+r+++++++l+a++lv+++ +ak+l++++Gd+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 276 AVGTPGDDA--TPFIIHNRKREDCRITAAPARLAAGTLVVDPLTAKRLQLNAGDQ 328 ***998665..******************************************** PP TIGR03244 331 vrvval 336 vr val lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1973 329 VRAVAL 334 ***986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.32 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory