GapMind for catabolism of small carbon sources


Alignments for a candidate for astD in Pseudomonas fluorescens GW456-L13

Align Succinylglutamic semialdehyde dehydrogenase (EC (characterized)
to candidate PfGW456L13_1974 Succinylglutamic semialdehyde dehydrogenase (EC

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1974
         (488 letters)

          Length = 488

 Score =  962 bits (2487), Expect = 0.0
 Identities = 488/488 (100%), Positives = 488/488 (100%)









Query: 481 LTPGVKMA 488
Sbjct: 481 LTPGVKMA 488

Lambda     K      H
   0.316    0.132    0.388 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 955
Number of extensions: 24
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 488
Length of database: 488
Length adjustment: 34
Effective length of query: 454
Effective length of database: 454
Effective search space:   206116
Effective search space used:   206116
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

Align candidate PfGW456L13_1974 (Succinylglutamic semialdehyde dehydrogenase (EC
to HMM TIGR03240 (astD: succinylglutamate-semialdehyde dehydrogenase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03240.hmm
# target sequence database:        /tmp/gapView.31966.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03240  [M=484]
Accession:   TIGR03240
Description: arg_catab_astD: succinylglutamate-semialdehyde dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
   8.6e-256  835.1   1.8   9.8e-256  834.9   1.8    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1974  Succinylglutamic semialdehyde de

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1974  Succinylglutamic semialdehyde dehydrogenase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  834.9   1.8  9.8e-256  9.8e-256       1     484 []       4     487 ..       4     487 .. 1.00

  Alignments for each domain:
  == domain 1  score: 834.9 bits;  conditional E-value: 9.8e-256
                                               TIGR03240   1 lfidGkwraGqGeslesldpvtqevlwqgkaasaaqvekavkaarkafpawarls 55 
                                                             l+i G+w aG Ge++esl+pvtq+vlw+g +a+a qve+av+aar+afp+war++
                                                             59***************************************************** PP

                                               TIGR03240  56 leeriavvkrfaelleeekeelaeviaketgkplweartevasmvakvaisikay 110
                                                             leeri+v++ fa+ l+++++ela++i++etgkplwea+tev+smv+k+ais+++y
                                                             ******************************************************* PP

                                               TIGR03240 111 eertGekeseladakavlrhrphGvlavfGpynfpGhlpnGhivpallaGntvvf 165
                                                             +ertGek+ +l+da+avlrh+phGv+avfGpynfpGhlpnGhivpallaGn+v+f
                                                             ******************************************************* PP

                                               TIGR03240 166 kpseltplvaeetvklwekaGlpaGvlnlvqGaretGkalaaeedidGllftGss 220
                                                             kpseltp+vae tvk+w +aGlpaGvlnl+qGaretG alaa+++idGl+ftGss
                                                             ******************************************************* PP

                                               TIGR03240 221 ntGallhrqlagrpekilalelGGnnplvveevkdidaavhlivqsafisaGqrc 275
                                                             ******************************************************* PP

                                               TIGR03240 276 tcarrllvkdgaeGdallerlvevaerltvgkydaepqpflGavisekaakella 330
                                                             tcarrllv++ga+Gd+ll+rlv+v+++l vg++d++p+pf+G+v+s  aak+l++
                                                             ******************************************************* PP

                                               TIGR03240 331 aqekllalggksllelkqleeeaalltpgiidvtevaevpdeeyfgpllkvlryk 385
                                                             aqe+lla+g+ +lle++q ++++alltpgi+dv++va++pdee+fgpll+v+ry+
                                                             ******************************************************* PP

                                               TIGR03240 386 dfdealaeanntrfGlaaGllsddrelydkflleiraGivnwnkpltGassaapf 440
                                                             ******************************************************* PP

                                               TIGR03240 441 GGiGasGnhrpsayyaadycaypvasleadslalpatlspGlkl 484
                                                             GG+GasGnhr+sayyaadycaypvasle+ sl+lp  l+pG+k+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1974 444 GGVGASGNHRASAYYAADYCAYPVASLETPSLVLPSALTPGVKM 487
                                                             *****************************************985 PP

Internal pipeline statistics summary:
Query model(s):                            1  (484 nodes)
Target sequences:                          1  (488 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 12.30

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory