Align ornithine δ-aminotransferase (EC 2.6.1.13) (characterized)
to candidate PfGW456L13_1158 Acetylornithine aminotransferase (EC 2.6.1.11)
Query= metacyc::MONOMER-16810 (468 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1158 Length = 427 Score = 212 bits (539), Expect = 2e-59 Identities = 139/391 (35%), Positives = 200/391 (51%), Gaps = 15/391 (3%) Query: 39 IEYESDYSAHNYHPIPMVFSKAKDVHVWDPEGRKYLDFLSAYSAVNQGHCHEKILNALSQ 98 + S+Y + VF + + +WD + R YLDF A + GH ++NA++ Sbjct: 27 VNLSSEYLMPSVERPKQVFVRGQGSWLWDSDDRAYLDFSQGGGANSLGHSPSVLVNAITA 86 Query: 99 QAQQLTLSSRAFHNDIFPIFAQHLTSMFGYEMILPMNTGAEGVETALKLARKWGYEKKHI 158 QAQ L HN A+HL + G + +NTG+E E A+KLARKWG ++H Sbjct: 87 QAQSLINPGFGLHNRGMLSLAEHLCASTGSDQAYLLNTGSEACEAAIKLARKWG--QRHR 144 Query: 159 PKNEAIIISCCGCFHGRTTAVISMSCDNEATRGFGPFLPGLLKVDFGDADSLKSMFEAHG 218 II++ GC HGR+ A IS S + F P LPG +V F D L ++ A Sbjct: 145 GGASRIIVANNGC-HGRSLATISASDSSTLANRFEPQLPGFSRVPFND---LPALHAAVD 200 Query: 219 DKVAGFLFEPIQGEAGVIVPPKGYLQSVRELCSKYNVLMIADEIQTGIGRTGKLLACEWE 278 ++ + EPIQ EAGV+ YL+ V LC + +L+I DE+QTGIGR G LLA + Sbjct: 201 ERTVAIMLEPIQSEAGVVPATVHYLKGVERLCRELGILLIFDEVQTGIGRCGSLLAEQSC 260 Query: 279 SVRPDVVILGKALGGGVLPVSAVLADKDIMLCFKPGEHGSTFGGNPLASAVAIAALEIVE 338 V D+V+LGK LGGGV P++A+LA + CF GE T GN L +A ++ L+ V+ Sbjct: 261 GVTADIVVLGKGLGGGV-PLAALLA-RGKACCFDIGELAGTHHGNALMTAAGLSVLDTVQ 318 Query: 339 EEKLAERAAEMGQVFRSQFLDIQKAYPHIIKEVRGQGLLNAVELNAKGLSTVSAFDICQR 398 ++ + AE GQ R + Y H E+RGQGLL + LS SA + + Sbjct: 319 DKAFLKHVAEAGQHLREGLGRLAHRYGH--GELRGQGLLWGLT-----LSDDSADAVVKA 371 Query: 399 LKERGVLAKPTHGTIIRFSPPLTIRLKELTE 429 G+L +RF+P L + + E Sbjct: 372 ALYEGLLLNAPQADCLRFTPALNVSNANIDE 402 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 427 Length adjustment: 33 Effective length of query: 435 Effective length of database: 394 Effective search space: 171390 Effective search space used: 171390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory