Align arginase (EC 3.5.3.1) (characterized)
to candidate PfGW456L13_2689 Agmatinase (EC 3.5.3.11)
Query= metacyc::MONOMER-14988 (338 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Length = 333 Score = 112 bits (279), Expect = 2e-29 Identities = 90/296 (30%), Positives = 140/296 (47%), Gaps = 47/296 (15%) Query: 59 ASTSLLGIPLGHNSSFLQGPAFAPPLIREAIWCGSTNSTTEEGKILDDQRVLTDVGDLPV 118 A ++LG+P + + G F P IREA ST + D + DV L Sbjct: 35 ADVAVLGVPNDMGTQWRSGARFGPRGIREA----STLFSFGHAGAYDHE---DDVMYLTA 87 Query: 119 QELRDTGIDDDRLMST--------VSESVKLVMDENPLRPLVLGGDHSISYPVVRAVSEK 170 ++R + D ++ T +V+ ++D + P+VLGGDHS+ PV++A + Sbjct: 88 SDVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVM-PVVLGGDHSVHAPVIKAFEGR 146 Query: 171 LGGPVDILHLDAHPDIYDAFEGNKYSHASSFARIMEGGYARRLLQVGIRSINLEGR---E 227 GP+ I+H DAH D D G +Y H + R E + + Q+GIR+++ R E Sbjct: 147 --GPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNHIVGMTQMGIRNVSSSNRDDYE 204 Query: 228 QGKRFGVEQYEMRTFSRDRQFLENLKLGEGVKGV----------YISVDVDCLDPAFAPG 277 G + +R R GV+GV YI++D+D DP+ APG Sbjct: 205 AAHEAGSKILSVRDVRR-----------LGVEGVLALIPQNINYYITIDIDGFDPSIAPG 253 Query: 278 VSHFESGGLSFRDVLNILHNL----QGDIVGADVVEYNPQRDTADGMTAMVAAKLV 329 GG + +VL I+ L +G+IVG D+VE P D GMT+++AA+L+ Sbjct: 254 TGTPSHGGFLYYEVLEIIQALAKRSKGNIVGMDLVEVAPVYDPT-GMTSILAAQLL 308 Lambda K H 0.317 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 333 Length adjustment: 28 Effective length of query: 310 Effective length of database: 305 Effective search space: 94550 Effective search space used: 94550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory