Align Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; EC 3.5.3.1; EC 3.5.3.11 (characterized)
to candidate PfGW456L13_4435 Agmatinase (EC 3.5.3.11)
Query= SwissProt::P46637 (342 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 Length = 316 Score = 135 bits (339), Expect = 2e-36 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 22/293 (7%) Query: 54 LVRLLGGAKASTSLLGVPLGHNSSFLQGPAFAPPRIR-EAIWCGSTNSATEEGKELKDPR 112 L L A + +GVPL +S G F P IR E++ N AT G D Sbjct: 26 LPHLNTAAGLDAAFVGVPLDIGTSLRPGTRFGPREIRAESVMIRPYNMAT--GAAPFDSL 83 Query: 113 VLTDVGDVPVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVS 172 + D+GD+ + + +I ES ++E + + PL LGGDH+I+ P++RA+ Sbjct: 84 SVADIGDIAINTFNLLDA-----VRIIEESYDNILEHDVI-PLTLGGDHTITLPILRAIH 137 Query: 173 EKLGGPVDILHLDAHPDIYDCFEGNKYSHASSFARIMEGGYAR--RLLQVGIRSINQEG- 229 +K G V ++H+DAH D+ D G K +H ++F R +E G R++Q+G+R+ Sbjct: 138 KK-HGKVGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDPDRVVQIGLRAQGYTAD 196 Query: 230 -----REQGKRFGVEQYEMRTFSKDRPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSH 284 R QG F V Q E P++ ++ G VY+S D+D +DPA+APG Sbjct: 197 DFNWSRNQG--FRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGT 254 Query: 285 IEPGGLSFRDVLNILHNLQA-DVVGADVVEFNPQRDTVDGMTAMVAAKLVREL 336 E GGL+ + I+ Q D+VG D+VE +P DT G T+++AA L+ E+ Sbjct: 255 PEIGGLTTIQAIEIVRGCQGLDLVGCDLVEVSPAYDTT-GNTSLLAANLLYEM 306 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 316 Length adjustment: 28 Effective length of query: 314 Effective length of database: 288 Effective search space: 90432 Effective search space used: 90432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory