Align agmatinase (EC 3.5.3.11) (characterized)
to candidate PfGW456L13_2689 Agmatinase (EC 3.5.3.11)
Query= BRENDA::W5PHZ9 (361 letters) >lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Agmatinase (EC 3.5.3.11) Length = 333 Score = 170 bits (431), Expect = 4e-47 Identities = 108/305 (35%), Positives = 167/305 (54%), Gaps = 23/305 (7%) Query: 63 VGICSMMRLPMQATPEGLDA--ALVGVPLDIGTSNRPGARFGPRRIREESVMLRTANPST 120 VG C+ + P+ + LDA A++GVP D+GT R GARFGPR IRE S + + Sbjct: 16 VGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFGH--A 73 Query: 121 GAVPFQF---------LKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDH 171 GA + +++ D+GD ++ ++ S + +KI+ AG +P+ LGGDH Sbjct: 74 GAYDHEDDVMYLTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDH 133 Query: 172 TITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKRVVQI 231 ++ P+++A E GP+ ++H DAH+D D+ G + HG P RR + + + Q+ Sbjct: 134 SVHAPVIKAF-EGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNHI--VGMTQM 190 Query: 232 GIRG-SSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLD 290 GIR SS+ D Y + G +++ D + ++ + Q + YI+ DIDG D Sbjct: 191 GIRNVSSSNRDDYEAAHEAGSKILSVRDVRRLGVEGVLALIPQNIN---YYITIDIDGFD 247 Query: 291 PAYAPGTGTPEIAGLTPSQALEIIRGCQGL---NVVGCDLVEVSPPYDPSGNTALVAANL 347 P+ APGTGTP G + LEII+ N+VG DLVEV+P YDP+G T+++AA L Sbjct: 248 PSIAPGTGTPSHGGFLYYEVLEIIQALAKRSKGNIVGMDLVEVAPVYDPTGMTSILAAQL 307 Query: 348 LFEML 352 L + Sbjct: 308 LLNSI 312 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 333 Length adjustment: 29 Effective length of query: 332 Effective length of database: 304 Effective search space: 100928 Effective search space used: 100928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_2689 (Agmatinase (EC 3.5.3.11))
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.12222.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-59 187.4 0.1 2.5e-59 187.1 0.1 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Agmatinase (EC 3.5.3.11) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Agmatinase (EC 3.5.3.11) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 187.1 0.1 2.5e-59 2.5e-59 8 273 .. 30 312 .. 23 314 .. 0.85 Alignments for each domain: == domain 1 score: 187.1 bits; conditional E-value: 2.5e-59 TIGR01230 8 aeyeeAevvivgiPydattsyrpGsrhgpeaireastnLeayse.eldrdlal.. 59 ++ +A+v ++g+P d+ t +r G+r+gp ireast + +d++ + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 30 WDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFGHAgAYDHEDDVmy 84 56779*******************************9876544314443333233 PP TIGR01230 60 .....lkvvDagdlplaaGdaremvekieevveelleegkfvvaiGGeHsitlpv 109 +++vD+gd +++ d + ++ e v+++l++g ++v++GG+Hs+ pv lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 85 ltasdVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDHSVHAPV 139 44566***************99999999999************************ PP TIGR01230 110 irAvkkkfeklavvqfDAHtDlrdefegeklshacvmrrvlelg..lnvlqigiR 162 i+A + + +++ +++fDAH D de +g ++ h + rr+ e++ ++q+giR lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 140 IKAFEGR-GPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNhiVGMTQMGIR 193 ***9865.89*********************************94445789**** PP TIGR01230 163 ...sgikeeadlarennikvlk.reledeiaevlakvldkpv..yvtiDiDvlDP 211 s +++ + a+e + k+l+ r++ e + ++ +++ y+tiDiD++DP lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 194 nvsSSNRDDYEAAHEAGSKILSvRDVRRLGVEGVLALIPQNInyYITIDIDGFDP 248 554456788999*********999**998666666666555555*********** PP TIGR01230 212 afaPGvgtpepgGltskellk.lfv.laekekkvvGlDvvEvaPvydssevtalt 264 + aPG+gtp gG+ +e+l+ + ++++ ++vG+D+vEvaPvyd + +t ++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 249 SIAPGTGTPSHGGFLYYEVLEiIQAlAKRSKGNIVGMDLVEVAPVYDPTGMTSIL 303 *********************543314567889********************** PP TIGR01230 265 aaklalell 273 aa+l l+ + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 304 AAQLLLNSI 312 ***998765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.86 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory