Align agmatinase (EC 3.5.3.11) (characterized)
to candidate PfGW456L13_2689 Agmatinase (EC 3.5.3.11)
Query= BRENDA::W5PHZ9 (361 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Length = 333 Score = 170 bits (431), Expect = 4e-47 Identities = 108/305 (35%), Positives = 167/305 (54%), Gaps = 23/305 (7%) Query: 63 VGICSMMRLPMQATPEGLDA--ALVGVPLDIGTSNRPGARFGPRRIREESVMLRTANPST 120 VG C+ + P+ + LDA A++GVP D+GT R GARFGPR IRE S + + Sbjct: 16 VGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFGH--A 73 Query: 121 GAVPFQF---------LKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDH 171 GA + +++ D+GD ++ ++ S + +KI+ AG +P+ LGGDH Sbjct: 74 GAYDHEDDVMYLTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDH 133 Query: 172 TITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKRVVQI 231 ++ P+++A E GP+ ++H DAH+D D+ G + HG P RR + + + Q+ Sbjct: 134 SVHAPVIKAF-EGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNHI--VGMTQM 190 Query: 232 GIRG-SSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLD 290 GIR SS+ D Y + G +++ D + ++ + Q + YI+ DIDG D Sbjct: 191 GIRNVSSSNRDDYEAAHEAGSKILSVRDVRRLGVEGVLALIPQNIN---YYITIDIDGFD 247 Query: 291 PAYAPGTGTPEIAGLTPSQALEIIRGCQGL---NVVGCDLVEVSPPYDPSGNTALVAANL 347 P+ APGTGTP G + LEII+ N+VG DLVEV+P YDP+G T+++AA L Sbjct: 248 PSIAPGTGTPSHGGFLYYEVLEIIQALAKRSKGNIVGMDLVEVAPVYDPTGMTSILAAQL 307 Query: 348 LFEML 352 L + Sbjct: 308 LLNSI 312 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 333 Length adjustment: 29 Effective length of query: 332 Effective length of database: 304 Effective search space: 100928 Effective search space used: 100928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_2689 (Agmatinase (EC 3.5.3.11))
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.13877.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-59 187.4 0.1 2.5e-59 187.1 0.1 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Agmatinase (EC 3.5.3.11) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 Agmatinase (EC 3.5.3.11) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 187.1 0.1 2.5e-59 2.5e-59 8 273 .. 30 312 .. 23 314 .. 0.85 Alignments for each domain: == domain 1 score: 187.1 bits; conditional E-value: 2.5e-59 TIGR01230 8 aeyeeAevvivgiPydattsyrpGsrhgpeaireastnLeayse.eldrdlal.. 59 ++ +A+v ++g+P d+ t +r G+r+gp ireast + +d++ + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 30 WDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFGHAgAYDHEDDVmy 84 56779*******************************9876544314443333233 PP TIGR01230 60 .....lkvvDagdlplaaGdaremvekieevveelleegkfvvaiGGeHsitlpv 109 +++vD+gd +++ d + ++ e v+++l++g ++v++GG+Hs+ pv lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 85 ltasdVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDHSVHAPV 139 44566***************99999999999************************ PP TIGR01230 110 irAvkkkfeklavvqfDAHtDlrdefegeklshacvmrrvlelg..lnvlqigiR 162 i+A + + +++ +++fDAH D de +g ++ h + rr+ e++ ++q+giR lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 140 IKAFEGR-GPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNhiVGMTQMGIR 193 ***9865.89*********************************94445789**** PP TIGR01230 163 ...sgikeeadlarennikvlk.reledeiaevlakvldkpv..yvtiDiDvlDP 211 s +++ + a+e + k+l+ r++ e + ++ +++ y+tiDiD++DP lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 194 nvsSSNRDDYEAAHEAGSKILSvRDVRRLGVEGVLALIPQNInyYITIDIDGFDP 248 554456788999*********999**998666666666555555*********** PP TIGR01230 212 afaPGvgtpepgGltskellk.lfv.laekekkvvGlDvvEvaPvydssevtalt 264 + aPG+gtp gG+ +e+l+ + ++++ ++vG+D+vEvaPvyd + +t ++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 249 SIAPGTGTPSHGGFLYYEVLEiIQAlAKRSKGNIVGMDLVEVAPVYDPTGMTSIL 303 *********************543314567889********************** PP TIGR01230 265 aaklalell 273 aa+l l+ + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 304 AAQLLLNSI 312 ***998765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.88 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory