Align agmatinase (EC 3.5.3.11) (characterized)
to candidate PfGW456L13_4435 Agmatinase (EC 3.5.3.11)
Query= BRENDA::W5PHZ9 (361 letters) >lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 Agmatinase (EC 3.5.3.11) Length = 316 Score = 406 bits (1043), Expect = e-118 Identities = 199/308 (64%), Positives = 237/308 (76%) Query: 51 NQPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIREES 110 +QP + R GI +MMRLP T GLDAA VGVPLDIGTS RPG RFGPR IR ES Sbjct: 6 HQPLGGNEMPRFGGIATMMRLPHLNTAAGLDAAFVGVPLDIGTSLRPGTRFGPREIRAES 65 Query: 111 VMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGD 170 VM+R N +TGA PF L VAD+GD+ +N +NL D+ R+I Y I+ +PLTLGGD Sbjct: 66 VMIRPYNMATGAAPFDSLSVADIGDIAINTFNLLDAVRIIEESYDNILEHDVIPLTLGGD 125 Query: 171 HTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKRVVQ 230 HTIT PIL+AI +KHG VGLVH+DAH D D GEK+ HGT FRR V+EGLLD RVVQ Sbjct: 126 HTITLPILRAIHKKHGKVGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDPDRVVQ 185 Query: 231 IGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLD 290 IG+R T D + +SR+QGFRVV AE+CW KSL PLM EVR+++GG P+Y+SFDIDG+D Sbjct: 186 IGLRAQGYTADDFNWSRNQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGID 245 Query: 291 PAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFE 350 PA+APGTGTPEI GLT QA+EI+RGCQGL++VGCDLVEVSP YD +GNT+L+AANLL+E Sbjct: 246 PAWAPGTGTPEIGGLTTIQAIEIVRGCQGLDLVGCDLVEVSPAYDTTGNTSLLAANLLYE 305 Query: 351 MLCVLPKV 358 MLCVLP V Sbjct: 306 MLCVLPGV 313 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 316 Length adjustment: 28 Effective length of query: 333 Effective length of database: 288 Effective search space: 95904 Effective search space used: 95904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_4435 (Agmatinase (EC 3.5.3.11))
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.9102.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-68 217.0 0.0 2.4e-68 216.7 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 Agmatinase (EC 3.5.3.11) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 Agmatinase (EC 3.5.3.11) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.7 0.0 2.4e-68 2.4e-68 14 274 .. 36 308 .. 24 309 .. 0.94 Alignments for each domain: == domain 1 score: 216.7 bits; conditional E-value: 2.4e-68 TIGR01230 14 evvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagd 67 ++ vg+P+d ts rpG+r+gp ir s+ + y+ + ++ l v+D gd lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 36 DAAFVGVPLDIGTSLRPGTRFGPREIRAESVMIRPYNMATGaAPFDSLSVADIGD 90 56678********************************9998678*********** PP TIGR01230 68 lplaaGdaremvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklav 122 + + + + + v iee +++le+ ++++GG+H+itlp++rA++kk++k+ + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 91 IAINTFNLLDAVRIIEESYDNILEHDVIPLTLGGDHTITLPILRAIHKKHGKVGL 145 *******9*********************************************** PP TIGR01230 123 vqfDAHtDlrdefegeklshacvmrrvlelg....lnvlqigiRsg..ikeeadl 171 v++DAH+D+ d+ gek+ h ++ rr++e g +v+qig+R++ + +++++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 146 VHIDAHADVNDHMFGEKIAHGTTFRRAVEEGlldpDRVVQIGLRAQgyTADDFNW 200 *****************************99777779*******97446899*** PP TIGR01230 172 arennikvlk.relede.....iaevlakvldkpvyvtiDiDvlDPafaPGvgtp 220 r+++ +v++ e ++ +aev kv + pvy+++DiD++DPa+aPG+gtp lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 201 SRNQGFRVVQaEECWHKsleplMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTP 255 *******99855555555666699999**************************** PP TIGR01230 221 epgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 e+gGlt+ ++++ v++ + +vG+D+vEv+P+yd++ t l+aa+l +e+l lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4435 256 EIGGLTTIQAIE-IVRGCQGLDLVGCDLVEVSPAYDTTGNTSLLAANLLYEMLC 308 ************.99*************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (316 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.86 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory