Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate PfGW456L13_2346 glutamine ABC transporter ATP-binding component
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2346 Length = 515 Score = 229 bits (583), Expect = 1e-64 Identities = 126/243 (51%), Positives = 165/243 (67%), Gaps = 8/243 (3%) Query: 1 MISIKSINKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 ++ +K+I K YG QVL V+ G+V+ + GPSGSGK++LI+ VN LE GDI++ Sbjct: 260 ILQLKNIQKSYGTHQVLMGIDLNVEYGQVVSIIGPSGSGKTSLIRTVNGLETIDTGDILL 319 Query: 61 DGTSI--ADPKTNLPKLRS---RVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATK 115 G A K N +LR +GMVFQ+F LFPH TI +N+T+A + G+ E + Sbjct: 320 FGEKFIEASDKPNSTRLRKGVRHIGMVFQNFNLFPHRTILDNVTLAP-RYHGQPGELSEH 378 Query: 116 KGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEV 175 + LL++VGL AHAHK+P QLSGGQQQRVAIARALAM+P +MLFDEPTSALDPE+VN+V Sbjct: 379 RAYALLDKVGLLAHAHKYPHQLSGGQQQRVAIARALAMEPQIMLFDEPTSALDPELVNDV 438 Query: 176 LDVMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQ 235 L+V+ LA EGMTM+ VTHEM FA ++DRV+FM+ G I D E D A ER + Sbjct: 439 LNVIRDLAKEGMTMLIVTHEMDFAMSISDRVVFMENGNIQLDAAPETIRCD--AEGERVR 496 Query: 236 HFL 238 F+ Sbjct: 497 RFM 499 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 515 Length adjustment: 29 Effective length of query: 215 Effective length of database: 486 Effective search space: 104490 Effective search space used: 104490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory