Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate PfGW456L13_3607 Amino acid ABC transporter, permease protein
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3607 Length = 281 Score = 80.9 bits (198), Expect = 4e-20 Identities = 57/159 (35%), Positives = 86/159 (54%), Gaps = 17/159 (10%) Query: 217 VLMLLTQLSWPQQ-LQPGQIRGGL-RLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAG 274 + +LL L PQ + PG I G+ LSL + GA+++EI R GI++V G Sbjct: 128 IQILLIYLGLPQLGVVPGAISAGIIALSLNY-----------GAYLSEIFRAGIMAVAPG 176 Query: 275 QWEAAAALGLTRSQTLWQIVVPQALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQT 334 Q EAA ALGL T IV+PQA+R I+P SQ++ K+SSL +G ++ AQ+ Sbjct: 177 QREAAMALGLGPVATFLHIVLPQAMRTIIPPTTSQFISMLKDSSLISVMGVWEVMFLAQS 236 Query: 335 TLNQTGRPVEVFLILMLTYLAINAVISAGMNGLQQRLQR 373 GR ++ ++ T I ++S G+ +Q RL+R Sbjct: 237 ----YGRSSYRYIEMLTTAAVIYWLLSIGLELIQNRLER 271 Score = 27.3 bits (59), Expect = 5e-04 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Query: 99 LTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQLIVWY--FPILLSLPAA 152 L+ ++G + +A S + + ++ Y + R TPLL+Q+++ Y P L +P A Sbjct: 91 LSLLLGFVTALARLSRSAVAFGVASFYASFFRGTPLLIQILLIYLGLPQLGVVPGA 146 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 281 Length adjustment: 28 Effective length of query: 349 Effective length of database: 253 Effective search space: 88297 Effective search space used: 88297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory