Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate PfGW456L13_4763 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= TCDB::P96483 (377 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4763 Length = 345 Score = 241 bits (616), Expect = 2e-68 Identities = 119/219 (54%), Positives = 158/219 (72%) Query: 20 AVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKDRDI 79 AVD++ I I+DGEF ++GPSG GK+T LR++AG E + G+IRI + LPP RD+ Sbjct: 19 AVDRVSIDIQDGEFFSMLGPSGSGKTTCLRLIAGFEQPSAGSIRIHGEEAAGLPPYQRDV 78 Query: 80 AMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKPKALSGG 139 VFQ+YAL+PHM V DN+ + LK+ GV KAE ++ EEA ++ L Y +RKP LSGG Sbjct: 79 NTVFQDYALFPHMNVRDNVAYGLKVKGVGKAERLKRAEEALDMVALGGYGERKPVQLSGG 138 Query: 140 QRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQVEA 199 QRQRVA+ RA+V P+V L+DEPL LD KLR + ++ LQR+LGIT ++VTHDQ EA Sbjct: 139 QRQRVALARALVNRPRVLLLDEPLGALDLKLREQMQGELKKLQRQLGITFIFVTHDQTEA 198 Query: 200 MTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGS 238 ++M DRVAV G ++QVDSPRN+Y KPA FVA F+G+ Sbjct: 199 LSMSDRVAVFNKGRIEQVDSPRNLYMKPATTFVAEFVGT 237 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 345 Length adjustment: 29 Effective length of query: 348 Effective length of database: 316 Effective search space: 109968 Effective search space used: 109968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory