Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate PfGW456L13_80 ABC transporter (iron.B12.siderophore.hemin) , permease component
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_80 Length = 336 Score = 179 bits (454), Expect = 9e-50 Identities = 104/280 (37%), Positives = 159/280 (56%), Gaps = 2/280 (0%) Query: 53 EALVQNLRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALS 112 E +V +R+PR L+ L+GA LAL G +LQ +T NP+A P LLG+ SGA L A+ L Sbjct: 58 EHIVWLIRVPRMLLGALVGAGLALIGAVLQAVTRNPLADPHLLGVTSGATLG-AVIVVLH 116 Query: 113 PTPIAGYSLSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLL 172 I G IAA G + +LV+ D ++L+L G+A+S M + + L Sbjct: 117 VGEIVGLLTLPIAAFIGALLSMLVVLMIASRHGRLDSDRLLLCGVAVSFVMMAIANLLLF 176 Query: 173 LAEDHAYG-IFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTL 231 + + A + +W+ GG+ ARW+ + V+ + ++L +A LN L + TA TL Sbjct: 177 MGDHRASSAVMFWMLGGLGLARWELLAVPTASVLFGLILLLGMARPLNALMAGEQTAVTL 236 Query: 232 GVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGA 291 G+N +RL + ++ L+ G VS++G + F+GL+VPH+AR G + R +LPV +LLG+ Sbjct: 237 GLNARTVRLRVFLIASLMTGVLVSISGSIGFVGLMVPHIARRLVGAEHRRLLPVCVLLGS 296 Query: 292 TLMLLADVLARALAFPGDLPAGAVLALIGSPCFVWLVRRR 331 ++ DV AR + P DLP G A IG F+ L+RRR Sbjct: 297 VFLVWVDVAARTMIAPEDLPIGVATAAIGGLFFIGLMRRR 336 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 336 Length adjustment: 28 Effective length of query: 304 Effective length of database: 308 Effective search space: 93632 Effective search space used: 93632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory