Align TctB aka STM2787, component of The tricarboxylate transporter, TctABC (characterized)
to candidate PfGW456L13_4527 Tricarboxylate transport protein TctB
Query= TCDB::Q9FA45 (144 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4527 Length = 152 Score = 95.9 bits (237), Expect = 2e-25 Identities = 51/145 (35%), Positives = 88/145 (60%), Gaps = 5/145 (3%) Query: 1 MMSDRIFAGIWLLLCIAGLFIAWQIQSEYSYEPVGPRPFPLGIIGLMALCALALL----- 55 M+ RIFA + LL C++ + +AW Q+ +SYEP+GPR FPL ++GLM L + ++ Sbjct: 1 MLLQRIFASVLLLACLSLVAMAWPYQAPFSYEPIGPRAFPLLMLGLMGLALVYMVYRPSP 60 Query: 56 LRHPDTVSWPRRHVLQKLITMIIILLMYAWGFEWLGFPIATALLTMVIGMLFGATIPAAG 115 ++H D R L K+ +++LL++A FE LGF +++ L+ + + L+G Sbjct: 61 IKHTDEEPPLDRETLTKIGVCVLLLLVFAGLFEPLGFILSSMLVGIPMARLYGGRWLPGA 120 Query: 116 ISGAVLGILLWYAFDRLLDVTLPLG 140 I +++ + L+ FD+++DV LPLG Sbjct: 121 IIISLMSVGLYLLFDKVMDVPLPLG 145 Lambda K H 0.332 0.147 0.498 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 99 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 144 Length of database: 152 Length adjustment: 16 Effective length of query: 128 Effective length of database: 136 Effective search space: 17408 Effective search space used: 17408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory