GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PRO3 in Pseudomonas fluorescens GW456-L13

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate PfGW456L13_1010 Pyrroline-5-carboxylate reductase (EC 1.5.1.2)

Query= SwissProt::P22008
         (273 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010
           Pyrroline-5-carboxylate reductase (EC 1.5.1.2)
          Length = 272

 Score =  385 bits (990), Expect = e-112
 Identities = 201/273 (73%), Positives = 236/273 (86%), Gaps = 1/273 (0%)

Query: 1   MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60
           MS  RIAFIGAGNMAASLIGGLRA+G+ AAQIRASDPG E RA+++ E  I+    NA+A
Sbjct: 1   MSKTRIAFIGAGNMAASLIGGLRAKGLEAAQIRASDPGEETRARVSAEHGIETFADNAQA 60

Query: 61  VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMP 120
           +  ADVVVL+VKPQAMKAVC+A+ P+LKP QL+VSIAAGI CAS+  WLG  +P+VRCMP
Sbjct: 61  IDGADVVVLAVKPQAMKAVCEAIRPSLKPHQLVVSIAAGITCASMNNWLGA-QPIVRCMP 119

Query: 121 NTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYF 180
           NTPAL+RQGASGL+A  +VSA Q +QA +LLSAVGIALWL++E Q+DAVTAVSGSGPAYF
Sbjct: 120 NTPALVRQGASGLFATTEVSAEQRQQAQELLSAVGIALWLNEEQQLDAVTAVSGSGPAYF 179

Query: 181 FLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAA 240
           FLL++AMT AG KLGL  + A++LTLQTALGAA MA+SS+V+ AELRRRVTSP GTTEAA
Sbjct: 180 FLLIEAMTAAGVKLGLPADIAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAA 239

Query: 241 IKSFQANGFEALVEQALNAASQRSAELAEQLGQ 273
           IKSFQANGFEALVE+AL AA+ RSAE+AEQLGQ
Sbjct: 240 IKSFQANGFEALVEKALGAAAHRSAEMAEQLGQ 272


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 278
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 272
Length adjustment: 25
Effective length of query: 248
Effective length of database: 247
Effective search space:    61256
Effective search space used:    61256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate PfGW456L13_1010 (Pyrroline-5-carboxylate reductase (EC 1.5.1.2))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00112.hmm
# target sequence database:        /tmp/gapView.6738.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
    7.6e-82  260.9  10.0    8.5e-82  260.7  10.0    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010  Pyrroline-5-carboxylate reductas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010  Pyrroline-5-carboxylate reductase (EC 1.5.1.2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  260.7  10.0   8.5e-82   8.5e-82       1     263 []       6     266 ..       6     266 .. 0.98

  Alignments for each domain:
  == domain 1  score: 260.7 bits;  conditional E-value: 8.5e-82
                                               TIGR00112   1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaee 55 
                                                             ia+iGaGnm+++l+ gl +kg   +++i   ++ ee +a+  +e g+e+ +d+++
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010   6 IAFIGAGNMAASLIGGLRAKGLE-AAQIRASDPGEETRARVSAEHGIETFADNAQ 59 
                                                             89**************9999776.8****************************** PP

                                               TIGR00112  56 avkeadvvllavKPqdleevlaelkseektkeklliSilAGvtiekleqlleaek 110
                                                             a++ advv+lavKPq +++v++ ++  + + ++l++Si+AG+t++ ++++l+a +
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010  60 AIDGADVVVLAVKPQAMKAVCEAIRP-SLKPHQLVVSIAAGITCASMNNWLGA-Q 112
                                                             **********************9998.6669********************86.9 PP

                                               TIGR00112 111 rvvRvmPNtaakvgagvtaiaassevseeqkelveellkavGkvveve.ekllda 164
                                                             ++vR+mPNt+a v++g+++++a++evs+eq+++++ell+avG +++++ e++lda
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010 113 PIVRCMPNTPALVRQGASGLFATTEVSAEQRQQAQELLSAVGIALWLNeEQQLDA 167
                                                             9***********************************************99***** PP

                                               TIGR00112 165 vtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehp 219
                                                             vta+sGSgPA++flliea+ +agvklGLp++ a +l+ qt  Gaa++   s+ ++
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010 168 VTAVSGSGPAYFFLLIEAMTAAGVKLGLPADIAAQLTLQTALGAAHMAVSSDVDA 222
                                                             ******************************************************* PP

                                               TIGR00112 220 alLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263
                                                             a+L+ +VtsP+GtT a++++++++g+++ v++a+ aa++rs e+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1010 223 AELRRRVTSPAGTTEAAIKSFQANGFEALVEKALGAAAHRSAEM 266
                                                             ****************************************9885 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (272 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 9.08
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory